CX308527

Overview
NameCX308527
Unique NameCX308527
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length446
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB4_PEA (Leghemoglobin Lb120-8 OS=Pisum sativum PE=2 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 4.384e-18
Identity = 53/119 (44.54%), Postives = 78/119 (65.55%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FTE+ EALV  SW + K+N     + F+  I + AP+A+ +FSFL+DS   +  + KL+ HA  VF M  +SA+QLR +G+V + + TL   GA+H + GV++ HF V K +LL+TIKE
Sbjct:    3 FTEKQEALVNSSWELFKQNPS-YSVLFYTIILKKAPAAKGMFSFLKDS-AEVVDSPKLQAHAEKVFGMVHDSAIQLRASGEVVLGDVTL---GAIHIQKGVIDPHFVVVKEALLDTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB2_PEA (Leghemoglobin Lb5-10 OS=Pisum sativum PE=2 SV=3)

HSP 1 Score: 88.9669 bits (219), Expect = 9.766e-18
Identity = 52/119 (43.70%), Postives = 75/119 (63.03%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FT++ EALV  SW   K+N     + F+  I E AP+A+ LFSFL+D+   +E + KL+ HA  VF +  +SA QLR  G+V +  +T   LGA+H + GV + HF V K +LL+TIK+
Sbjct:    3 FTDKQEALVNSSWESFKQNLSGNSILFYTIILEKAPAAKGLFSFLKDT-AGVEDSPKLQAHAEQVFGLVRDSAAQLRTKGEVVLGNAT---LGAIHVQRGVTDPHFVVVKEALLQTIKK 117          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB3_VICFA (Leghemoglobin 49 OS=Vicia faba PE=2 SV=3)

HSP 1 Score: 87.4261 bits (215), Expect = 2.841e-17
Identity = 52/119 (43.70%), Postives = 76/119 (63.87%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FT++ EALV  SW   K+N     + F+  I E AP+A+ +FSFL+DS   +  + KL+ HA  VF M  +SA+QL+  G+V ++  +L   GA+H + GVV+ HF V K +LL+TIKE
Sbjct:    3 FTQQQEALVNSSWESFKQNPS-YSVLFYTIILEKAPAAKGMFSFLKDS-AGVVDSPKLQAHAEQVFGMVRDSAIQLQATGEVVLKNGSL---GAIHIQKGVVDPHFVVVKEALLKTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB2_SESRO (Leghemoglobin 2 OS=Sesbania rostrata GN=GLB2 PE=1 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 6.330e-17
Identity = 50/119 (42.02%), Postives = 75/119 (63.03%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FTE+ EALV  S+   K+N     + F+  I E AP+A+ +FSFL+DS+   + N  L+ HA  VF +  +SA QLR  G V + +++   LG+VH + GV++ HF V K +LL+T+KE
Sbjct:    3 FTEKQEALVNASYEAFKQNLPGNSVLFYSFILEKAPAAKGMFSFLKDSDGVPQNNPSLQAHAEKVFGLVRDSAAQLRATGVVVLADAS---LGSVHVQKGVLDPHFVVVKEALLKTLKE 118          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_LUPLU (Leghemoglobin-1 OS=Lupinus luteus PE=1 SV=3)

HSP 1 Score: 86.2705 bits (212), Expect = 6.330e-17
Identity = 50/113 (44.25%), Postives = 70/113 (61.95%), Query Frame = 1
Query:  106 ALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            ALV  S+     N  +   +FF  + EIAP A+ LFSFL+ S+   + N  L+ HA  VF +T E+A+QL+  G V   ++TLK LG+VH   GVV+ HF V K ++L+TIKE
Sbjct:   10 ALVKSSFEEFNANIPKNTHRFFTLVLEIAPGAKDLFSFLKGSSEVPQNNPDLQAHAGKVFKLTYEAAIQLQVNGAV-ASDATLKSLGSVHVSKGVVDAHFPVVKEAILKTIKE 121          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_MEDTR (Leghemoglobin 1 OS=Medicago truncatula GN=LB1 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.080e-16
Identity = 51/120 (42.50%), Postives = 76/120 (63.33%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            +FT++ EALV  S+   K+N     + F+  I E AP+A+ LFSFL+DS   ++ + +L+ HA  VF +  +SA QLR  G V + ++    LGA+H + GVV+ HF V K +LL+TIKE
Sbjct:    2 SFTDKQEALVNSSYEAFKQNLSGYSVFFYTVILEKAPAAKGLFSFLKDS-AGVQDSPQLQAHAEKVFGLVRDSASQLRATGGVVLGDAA---LGAIHIQKGVVDPHFVVVKEALLKTIKE 117          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB3_SESRO (Leghemoglobin 3 OS=Sesbania rostrata GN=GLB3 PE=2 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 2.405e-16
Identity = 49/119 (41.18%), Postives = 74/119 (62.18%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FTE+ EALV  S+   K+N     + F+  I E AP+A+ +FSFL+D +   + N  L+ HA  VF +  +SA QLR  G V + +++   LG+VH + GV++ HF V K +LL+T+KE
Sbjct:    3 FTEKQEALVNASYEAFKQNLPGNSVLFYSFILEKAPAAKGMFSFLKDFDEVPQNNPSLQAHAEKVFGLVRDSAAQLRATGVVVLADAS---LGSVHVQKGVLDPHFVVVKEALLKTLKE 118          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB_LOTJA (Leghemoglobin OS=Lotus japonicus PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.142e-16
Identity = 49/119 (41.18%), Postives = 75/119 (63.03%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FT + EALV  S+   KKN     + F+  I EIAP+A+ +FSFL++S    + + +L+ HA  VF +T ++A QL   G+VT+ +++   LGAVH +  V + HF V K +LL+T+KE
Sbjct:    3 FTAQQEALVGSSYETFKKNLPTNSVLFYTVILEIAPTAKDMFSFLKESGP--KHSPQLQAHAEKVFALTRDAATQLVAKGEVTLADAS---LGAVHVQKAVTDPHFVVVKEALLQTVKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGBA_PHAVU (Leghemoglobin A OS=Phaseolus vulgaris PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 9.141e-16
Identity = 51/120 (42.50%), Postives = 70/120 (58.33%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AFTE+ EALV  SW   K N  +  + F+  I E AP+A+ LFSFL +   P   N KL  HA S+F +  +SA QLR  G V    +    LG++H + GV N+ F V K +LL+T+K+
Sbjct:    3 AFTEKQEALVNSSWEAFKGNIPQYSVVFYTSILEKAPAAKNLFSFLANGVDP--TNPKLTAHAESLFGLVRDSAAQLRANGAVVADAA----LGSIHSQKGVSNDQFLVVKEALLKTLKQ 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_PEA (Leghemoglobin-1 OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 9.141e-16
Identity = 51/119 (42.86%), Postives = 75/119 (63.03%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FT++ EALV  S +  K+N     + F+  + E AP+A+ LFSFL+D+   +E + KL+ HA  VF +  +SA QLR  G+V +  +TL   GA+H + GV N HF V K +LL+TIK+
Sbjct:    3 FTDKQEALV-NSSSEFKQNLPGYSILFYTIVLEKAPAAKGLFSFLKDT-AGVEDSPKLQAHAEQVFGLVRDSAAQLRTKGEVVLGNATL---GAIHVQKGVTNPHFVVVKEALLQTIKK 116          
The following BLAST results are available for this feature:
BLAST of CX308527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
LGB4_PEA4.384e-1844.54Leghemoglobin Lb120-8 OS=Pisum sativum PE=2 SV=3[more]
LGB2_PEA9.766e-1843.70Leghemoglobin Lb5-10 OS=Pisum sativum PE=2 SV=3[more]
LGB3_VICFA2.841e-1743.70Leghemoglobin 49 OS=Vicia faba PE=2 SV=3[more]
LGB2_SESRO6.330e-1742.02Leghemoglobin 2 OS=Sesbania rostrata GN=GLB2 PE=1 ... [more]
LGB1_LUPLU6.330e-1744.25Leghemoglobin-1 OS=Lupinus luteus PE=1 SV=3[more]
LGB1_MEDTR1.080e-1642.50Leghemoglobin 1 OS=Medicago truncatula GN=LB1 PE=2... [more]
LGB3_SESRO2.405e-1641.18Leghemoglobin 3 OS=Sesbania rostrata GN=GLB3 PE=2 ... [more]
LGB_LOTJA3.142e-1641.18Leghemoglobin OS=Lotus japonicus PE=2 SV=1[more]
LGBA_PHAVU9.141e-1642.50Leghemoglobin A OS=Phaseolus vulgaris PE=1 SV=2[more]
LGB1_PEA9.141e-1642.86Leghemoglobin-1 OS=Pisum sativum PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001A01Rv AbsLeaSub1 Citrus clementina cDNA clone C21001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308527 ID=CX308527|Name=CX308527|organism=Citrus clementina|type=EST|length=446bp
GCGGGGATTCAACAACATTTTGTGTATCACATTCAATCCTCAGGTGTCCA
AAAGAAATCAATGGCCAACATTAACGAAGGTAGAGCCTTTACTGAAGAGT
AAGAAGCTTTAGTTGTCAGGTCATGGAATGTAATGAAGAAGAATGCTGGA
GAATTGGGTCTTAAATTCTTCTTGAGGATCTTTGAGATTGCACCATCAGC
CCAAAAGCTGTTCTCATTCTTGAGAGACTCAAATGTGCCTCTAGAGCAGA
ACCAGAAGCTCAAGCCCCACGCCATGTCTGTTTTTGTTATGACGTGTGAA
TCAGCAGTGCAACTGAGGAAAGCAGGCAAAGTGACAGTAAGAGAATCAAC
TCTAAAAAAATTAGGAGCTGTCCACTTCAAATATGGTGTTGTTAATGAGC
ATTTTGAGGTCACAAAATTTTCACTACTGGAAACCATAAAAGAGGC
back to top