CX308527

Overview
NameCX308527
Unique NameCX308527
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length446
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_VICFA (Leghemoglobin-1 OS=Vicia faba PE=1 SV=2)

HSP 1 Score: 82.0333 bits (201), Expect = 1.194e-15
Identity = 51/119 (42.86%), Postives = 73/119 (61.34%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FTE+ EALV  S  + K+N     + F+  I + AP+A+ +FSFL+DS   +  + KL  HA  VF M  +SAVQLR  G+V +      K G++H + GV++ HF V K +LL+TIKE
Sbjct:    3 FTEKQEALVNSSSQLFKQNPSNYSVLFYTIILQKAPTAKAMFSFLKDS-AGVVDSPKLGAHAEKVFGMVRDSAVQLRATGEVVLD----GKDGSIHIQKGVLDPHFVVVKEALLKTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB2_PHAVU (Leghemoglobin OS=Phaseolus vulgaris PE=2 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 3.840e-14
Identity = 49/120 (40.83%), Postives = 68/120 (56.67%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AFTE+ EALV  SW   K N  +  + F+  I E AP+A+ LFSFL +   P   N KL  HA S+F +  +SA QLR  G V    +    LG++H +  + +  F V K +LL+T+KE
Sbjct:    3 AFTEKQEALVNSSWEAFKGNIPQYSVVFYTSILEKAPAAKNLFSFLANGVDP--TNPKLTAHAESLFGLVRDSAAQLRANGAVVADAA----LGSIHSQKALNDSQFLVVKEALLKTLKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB2_VICFA (Leghemoglobin 29 OS=Vicia faba GN=LB29 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 4.246e-13
Identity = 48/120 (40.00%), Postives = 67/120 (55.83%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSN-VPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FT   EALV  SW    +N     + F+  I E AP A+ +FS L+D+N +PL  N  +  H   VF M  ++A QL+  G+V + ++T   LG VH +  V   HF V K +LL+TIKE
Sbjct:    3 FTLRQEALVNSSWEAFNQNLPLFSVLFYTFILEKAPIAKNMFSVLKDANEIPL-ANPSINAHTEMVFEMVRDAAAQLQTTGQVVLGDTT---LGVVHTQKRVDGLHFMVVKEALLKTIKE 118          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB_PSOTE (Leghemoglobin OS=Psophocarpus tetragonolobus PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.459e-13
Identity = 47/119 (39.50%), Postives = 66/119 (55.46%), Query Frame = 1
Query:   88 FTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            FTE+ EALV  S+   K N  +  + F+  I E AP+A+ LF FL +   P   N KL  HA  +F +  +SA QLR  G V    +    LG++H + GV +  F V K +LL+T+KE
Sbjct:    4 FTEKQEALVNSSYEAFKANVPQYSVVFYTSILEKAPAAKDLFPFLANGVDP--TNPKLIGHAEKLFGLVHDSAAQLRAKGAVVADAA----LGSLHAQKGVTDPQFVVVKEALLKTVKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB2_SOYBN (Leghemoglobin C2 OS=Glycine max PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 9.459e-13
Identity = 47/120 (39.17%), Postives = 67/120 (55.83%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AFTE+ EALV  S+   K N  +  + F+  I E AP+A+ LFSFL +   P   N KL  HA  +F +  +SA QL+  G V    +    LG++H +  + +  F V K +LL+TIKE
Sbjct:    3 AFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDP--SNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAA----LGSIHAQKAITDPQFVVVKEALLKTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGBA_SOYBN (Leghemoglobin A OS=Glycine max GN=LBA PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.235e-12
Identity = 47/119 (39.50%), Postives = 67/119 (56.30%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIK 441
            AFTE+ +ALV  S+   K N  +  + F+  I E AP+A+ LFSFL +   P   N KL  HA  +F +  +SA QL+ +G V    +    LG+VH +  V +  F V K +LL+TIK
Sbjct:    3 AFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDP--TNPKLTGHAEKLFALVRDSAGQLKASGTVVADAA----LGSVHAQKAVTDPQFVVVKEALLKTIK 115          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB3_SOYBN (Leghemoglobin C3 OS=Glycine max GN=LGB1 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.235e-12
Identity = 46/120 (38.33%), Postives = 68/120 (56.67%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AFT++ EALV  S+   K N  +  + F+  I E AP A+ LFSFL +   P   N KL  HA  +F +  +SA QL+ +G V +  +    LG++H +  + +  F V K +LL+TIKE
Sbjct:    3 AFTDKQEALVSSSFEAFKTNIPQYSVVFYTSILEKAPVAKDLFSFLANGVDP--TNPKLTGHAEKLFGLVRDSAGQLKASGTVVIDAA----LGSIHAQKAITDPQFVVVKEALLKTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_SOYBN (Leghemoglobin C1 OS=Glycine max PE=2 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 8.008e-12
Identity = 47/120 (39.17%), Postives = 66/120 (55.00%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AFTE+ EALV  S+   K N  +  + F+  I E AP+A+ LFSFL +   P   N KL  HA  +F +  +SA QL+  G V    +    L ++H +  V +  F V K +LL+TIKE
Sbjct:    3 AFTEKQEALVSSSFEAFKANIPQYSVVFYNSILEKAPAAKDLFSFLANGVDP--TNPKLTGHAEKLFALVRDSAGQLKTNGTVVADAA----LVSIHAQKAVTDPQFVVVKEALLKTIKE 116          
BLAST of CX308527 vs. ExPASy Swiss-Prot
Match: LGB1_VIGUN (Leghemoglobin-1 OS=Vigna unguiculata GN=LBI PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.784e-11
Identity = 46/120 (38.33%), Postives = 68/120 (56.67%), Query Frame = 1
Query:   85 AFTEE*EALVVRSWNVMKKNAGELGLKFFLRIFEIAPSAQKLFSFLRDSNVPLEQNQKLKPHAMSVFVMTCESAVQLRKAGKVTVRESTLKKLGAVHFKYGVVNEHFEVTKFSLLETIKE 444
            AF+++ EALV  ++   K N  +  + F+  I E AP+A+ LFSFL  +N     N KL  HA  +F +  +SA QLR +G V    +    LGAVH +  V +  F V K +L++T+KE
Sbjct:    3 AFSDKQEALVNGAYEAFKANIPKYSVVFYTTILEKAPAAKNLFSFL--ANGVDATNPKLTGHAEKLFGLVRDSAAQLRASGGVVADAA----LGAVHSQKAVNDAQFVVVKEALVKTLKE 116          
The following BLAST results are available for this feature:
BLAST of CX308527 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 49
Match NameE-valueIdentityDescription
LGB1_VICFA1.194e-1542.86Leghemoglobin-1 OS=Vicia faba PE=1 SV=2[more]
LGB2_PHAVU3.840e-1440.83Leghemoglobin OS=Phaseolus vulgaris PE=2 SV=3[more]
LGB2_VICFA4.246e-1340.00Leghemoglobin 29 OS=Vicia faba GN=LB29 PE=2 SV=1[more]
LGB_PSOTE9.459e-1339.50Leghemoglobin OS=Psophocarpus tetragonolobus PE=2 ... [more]
LGB2_SOYBN9.459e-1339.17Leghemoglobin C2 OS=Glycine max PE=1 SV=2[more]
LGBA_SOYBN1.235e-1239.50Leghemoglobin A OS=Glycine max GN=LBA PE=1 SV=2[more]
LGB3_SOYBN1.235e-1238.33Leghemoglobin C3 OS=Glycine max GN=LGB1 PE=2 SV=2[more]
LGB1_SOYBN8.008e-1239.17Leghemoglobin C1 OS=Glycine max PE=2 SV=2[more]
LGB1_VIGUN1.784e-1138.33Leghemoglobin-1 OS=Vigna unguiculata GN=LBI PE=2 S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001A01Rv AbsLeaSub1 Citrus clementina cDNA clone C21001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308527 ID=CX308527|Name=CX308527|organism=Citrus clementina|type=EST|length=446bp
GCGGGGATTCAACAACATTTTGTGTATCACATTCAATCCTCAGGTGTCCA
AAAGAAATCAATGGCCAACATTAACGAAGGTAGAGCCTTTACTGAAGAGT
AAGAAGCTTTAGTTGTCAGGTCATGGAATGTAATGAAGAAGAATGCTGGA
GAATTGGGTCTTAAATTCTTCTTGAGGATCTTTGAGATTGCACCATCAGC
CCAAAAGCTGTTCTCATTCTTGAGAGACTCAAATGTGCCTCTAGAGCAGA
ACCAGAAGCTCAAGCCCCACGCCATGTCTGTTTTTGTTATGACGTGTGAA
TCAGCAGTGCAACTGAGGAAAGCAGGCAAAGTGACAGTAAGAGAATCAAC
TCTAAAAAAATTAGGAGCTGTCCACTTCAAATATGGTGTTGTTAATGAGC
ATTTTGAGGTCACAAAATTTTCACTACTGGAAACCATAAAAGAGGC
back to top