CX308580

Overview
NameCX308580
Unique NameCX308580
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length364
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10014 contig Ccv1_Contig10014:400..761. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G2_MOUSE (Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus GN=Ube2g2 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.546e-32
Identity = 60/97 (61.86%), Postives = 75/97 (77.32%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L  NP +G  AG ++E N FEW A I+GP DT +E G F AI++FP +YP+SPP +RFT EM+HPN+YPDG+VCISILH PGDDP GYE + ERW+P
Sbjct:   16 LTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSP 112          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G2_HUMAN (Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens GN=UBE2G2 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.546e-32
Identity = 60/97 (61.86%), Postives = 75/97 (77.32%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L  NP +G  AG ++E N FEW A I+GP DT +E G F AI++FP +YP+SPP +RFT EM+HPN+YPDG+VCISILH PGDDP GYE + ERW+P
Sbjct:   16 LTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSP 112          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G2_BOVIN (Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.546e-32
Identity = 60/97 (61.86%), Postives = 75/97 (77.32%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L  NP +G  AG ++E N FEW A I+GP DT +E G F AI++FP +YP+SPP +RFT EM+HPN+YPDG+VCISILH PGDDP GYE + ERW+P
Sbjct:   16 LTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSP 112          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2G1_MACFA (Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fascicularis GN=UBE2G1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.637e-32
Identity = 58/98 (59.18%), Postives = 75/98 (76.53%), Query Frame = -2
Query:    1 DLCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 294
            +L KNPV+GFSAGL+D+++++ W   IIGPPDTLYEGG F A +TFP +YP+ PP ++F +E+WHPNV  +G VCISILH PG+D  GYE    RW P
Sbjct:   16 ELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEGRWLP 113          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2R2_RABIT (Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus cuniculus GN=UBE2R2 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.498e-32
Identity = 58/97 (59.79%), Postives = 73/97 (75.26%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L + PV+GF   LVDES+++ W  +I GPP+TLYEGG+F A + FP +YP SPPT RF ++MWHPN+Y +G VCISILHPP DDP   EL +ERW P
Sbjct:   20 LQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNP 116          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2R2_MOUSE (Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus GN=Ube2r2 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.498e-32
Identity = 58/97 (59.79%), Postives = 73/97 (75.26%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L + PV+GF   LVDES+++ W  +I GPP+TLYEGG+F A + FP +YP SPPT RF ++MWHPN+Y +G VCISILHPP DDP   EL +ERW P
Sbjct:   20 LQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNP 116          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2R2_HUMAN (Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens GN=UBE2R2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 4.498e-32
Identity = 58/97 (59.79%), Postives = 73/97 (75.26%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L + PV+GF   LVDES+++ W  +I GPP+TLYEGG+F A + FP +YP SPPT RF ++MWHPN+Y +G VCISILHPP DDP   EL +ERW P
Sbjct:   20 LQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNP 116          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2R1_MOUSE (Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 1.890e-30
Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L + PV+GF   LVDE +++ W  +I GPP+T YEGG+F A + FP +YP SPP  RF ++MWHPN+Y  G VCISILHPP DDP   EL +ERW P
Sbjct:   20 LQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNP 116          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UB2R1_HUMAN (Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2)

HSP 1 Score: 130.954 bits (328), Expect = 1.890e-30
Identity = 55/97 (56.70%), Postives = 69/97 (71.13%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L + PV+GF   LVDE +++ W  +I GPP+T YEGG+F A + FP +YP SPP  RF ++MWHPN+Y  G VCISILHPP DDP   EL +ERW P
Sbjct:   20 LQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNP 116          
BLAST of CX308580 vs. ExPASy Swiss-Prot
Match: UBC7_YEAST (Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharomyces cerevisiae GN=UBC7 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.037e-28
Identity = 56/97 (57.73%), Postives = 68/97 (70.10%), Query Frame = -2
Query:    1 LCKNPVDGFSAGLVDESNVFEWSASIIGPPDTLYEGGFFNAIMTFPDNYPVSPPTVRFTSEMWHPNVYPDGKVCISILHPPGDDPNGYELATERWTP 291
            L K+   G  AG   E+N+F W   I GPPDT Y  G FNA + FP +YP+SPP + FT  + HPN+YP+G+VCISILH PGDDPN YELA ERW+P
Sbjct:   16 LIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSP 112          
The following BLAST results are available for this feature:
BLAST of CX308580 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 129
Match NameE-valueIdentityDescription
UB2G2_MOUSE1.546e-3261.86Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus... [more]
UB2G2_HUMAN1.546e-3261.86Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens... [more]
UB2G2_BOVIN1.546e-3261.86Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus G... [more]
UB2G1_MACFA2.637e-3259.18Ubiquitin-conjugating enzyme E2 G1 OS=Macaca fasci... [more]
UB2R2_RABIT4.498e-3259.79Ubiquitin-conjugating enzyme E2 R2 OS=Oryctolagus ... [more]
UB2R2_MOUSE4.498e-3259.79Ubiquitin-conjugating enzyme E2 R2 OS=Mus musculus... [more]
UB2R2_HUMAN4.498e-3259.79Ubiquitin-conjugating enzyme E2 R2 OS=Homo sapiens... [more]
UB2R1_MOUSE1.890e-3056.70Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus... [more]
UB2R1_HUMAN1.890e-3056.70Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens... [more]
UBC7_YEAST1.037e-2857.73Ubiquitin-conjugating enzyme E2-18 kDa OS=Saccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001E07Rv AbsLeaSub1 Citrus clementina cDNA clone C21001E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308580 ID=CX308580|Name=CX308580|organism=Citrus clementina|type=EST|length=364bp
GGGAGTCCACCGTTCGGTTGCAAGCTCATAGCCATTTGGATCATCACCCG
GGGGATGAAGAATTGAAATGCAAACCTTTCCGTCAGGGTAAACATTAGGA
TGCCACATCTCTGATGTAAACCTCACAGTTGGAGGACTCACAGGGTAATT
ATCAGGAAAAGTCATTATGGCATTGAAGAATCCCCCCTCATATAAAGTAT
CAGGGGGTCCAATAATGGACGCACTCCATTCAAAGACATTGCTCTCATCC
ACCAACCCAGCAGAGAATCCATCAACTGGGTTCTTACAAAGATCTTTGAG
CTGCTTCTGAAGGAGGAGACTAGCCTGAGACTTCGCCATAGAAAAATATT
AGAGAGAACCCCCG
back to top