CX308599

Overview
NameCX308599
Unique NameCX308599
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length351
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14605 contig Ccv1_Contig14605:197..547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARD1_RAT (GTP-binding protein ARD-1 (Fragment) OS=Rattus norvegicus GN=Trim23 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.798e-36
Identity = 70/112 (62.50%), Postives = 88/112 (78.57%), Query Frame = -3
Query:   14 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL 349
            LK  E +  IPTIGFNVETVEYKN+ FT+WDVG + K+RPLW+HY+ NTQ ++FVVDS+ RDRI EA  EL ++L E ELRDA+LL+FANKQD+  A++  EIT+ L LH L
Sbjct:  404 LKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGEKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKL 515          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_HUMAN (ADP-ribosylation factor-like protein 1 OS=Homo sapiens GN=ARL1 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.522e-35
Identity = 70/115 (60.87%), Postives = 90/115 (78.26%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRI  ++ EL  ML E+ELR A+L+VFANKQD+  AM ++E+ + LGL +L+ R
Sbjct:   37 LQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTSSEMANSLGLPALKDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_BOVIN (ADP-ribosylation factor-like protein 1 OS=Bos taurus GN=ARL1 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.596e-35
Identity = 70/115 (60.87%), Postives = 89/115 (77.39%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRI  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R
Sbjct:   37 LQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANSLGLPALKDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_RAT (ADP-ribosylation factor-like protein 1 OS=Rattus norvegicus GN=Arl1 PE=1 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.391e-35
Identity = 70/115 (60.87%), Postives = 89/115 (77.39%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRI  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R
Sbjct:   37 LQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_MOUSE (ADP-ribosylation factor-like protein 1 OS=Mus musculus GN=Arl1 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 3.391e-35
Identity = 70/115 (60.87%), Postives = 89/115 (77.39%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVETV YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRI  ++ EL  ML E+ELR A+L+VFANKQD+  AM  +E+ + LGL +L+ R
Sbjct:   37 LQVGEVVTTIPTIGFNVETVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAVIYVVDSCDRDRIGISKSELVAMLEEEELRKAILVVFANKQDMEQAMTPSEMANALGLPALKDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF11_CAEEL (ADP-ribosylation factor 1-like 1 OS=Caenorhabditis elegans GN=arf-1.1 PE=3 SV=3)

HSP 1 Score: 146.362 bits (368), Expect = 4.429e-35
Identity = 73/115 (63.48%), Postives = 89/115 (77.39%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            LKL E V TIPTIGFNVETV ++ I+ TVWDVGGQ KIR LW++YF NT  L+FVVDS+D +RI EA++EL  +L E EL D+ LLVFANKQD+PNA + AE+T  L L SL+ R
Sbjct:   37 LKLNETVNTIPTIGFNVETVTFQKITLTVWDVGGQKKIRALWKYYFPNTTTLVFVVDSSDIERIPEAKEELFSLLAEPELADSHLLVFANKQDMPNARSPAELTQLLDLGSLKNR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_YEAST (ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae GN=ARL1 PE=1 SV=4)

HSP 1 Score: 145.591 bits (366), Expect = 7.554e-35
Identity = 68/115 (59.13%), Postives = 88/115 (76.52%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTT PTIGFNVET+ YKN+   VWD+GGQ  IRP WR Y+ +T  +IFVVDS D+DR+  A  ELH ML E+EL+DA LLVFANKQD P A++A+E++ +L L  L+ R
Sbjct:   38 LQIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDR 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_CAEEL (ADP-ribosylation factor-like protein 1 OS=Caenorhabditis elegans GN=arl-1 PE=2 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 3.749e-34
Identity = 69/115 (60.00%), Postives = 84/115 (73.04%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVE VEYKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDR+  +R EL  ML EDEL+ AVL V ANKQD+   +   E+   LGL +LR R
Sbjct:   36 LQVGEVVTTIPTIGFNVEQVEYKNLKFQVWDLGGQTSIRPYWRCYYANTDAIIYVVDSADRDRVGISRQELATMLQEDELQGAVLAVLANKQDIAGCLTETEVYKALGLDALRNR 150          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL1_DROME (ADP-ribosylation factor-like protein 1 OS=Drosophila melanogaster GN=Arf72A PE=1 SV=5)

HSP 1 Score: 142.51 bits (358), Expect = 6.395e-34
Identity = 68/115 (59.13%), Postives = 85/115 (73.91%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L++GE+VTTIPTIGFNVE V YKN+ F VWD+GGQ  IRP WR Y+ NT  +I+VVDS DRDRI  ++DEL  ML E+EL  A+L+V ANKQD+   M  AE+   LGL +L+ R
Sbjct:   36 LQVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNR 150          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARF3_YEAST (ADP-ribosylation factor 3 OS=Saccharomyces cerevisiae GN=ARF3 PE=1 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 2.057e-32
Identity = 63/109 (57.80%), Postives = 85/109 (77.98%), Query Frame = -3
Query:   23 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGL 349
            LKL +I T+ PT+GFNVETV YKN+ F +WDVGGQ ++RPLWRHYF  T  LIFV+DS+ R+R+ EA++EL+ ++ E E+ + VLLV+ANKQDL +AM   E++D L L
Sbjct:   37 LKLNKIKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLEL 145          
The following BLAST results are available for this feature:
BLAST of CX308599 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 212
Match NameE-valueIdentityDescription
ARD1_RAT1.798e-3662.50GTP-binding protein ARD-1 (Fragment) OS=Rattus nor... [more]
ARL1_HUMAN1.522e-3560.87ADP-ribosylation factor-like protein 1 OS=Homo sap... [more]
ARL1_BOVIN2.596e-3560.87ADP-ribosylation factor-like protein 1 OS=Bos taur... [more]
ARL1_RAT3.391e-3560.87ADP-ribosylation factor-like protein 1 OS=Rattus n... [more]
ARL1_MOUSE3.391e-3560.87ADP-ribosylation factor-like protein 1 OS=Mus musc... [more]
ARF11_CAEEL4.429e-3563.48ADP-ribosylation factor 1-like 1 OS=Caenorhabditis... [more]
ARL1_YEAST7.554e-3559.13ADP-ribosylation factor-like protein 1 OS=Saccharo... [more]
ARL1_CAEEL3.749e-3460.00ADP-ribosylation factor-like protein 1 OS=Caenorha... [more]
ARL1_DROME6.395e-3459.13ADP-ribosylation factor-like protein 1 OS=Drosophi... [more]
ARF3_YEAST2.057e-3257.80ADP-ribosylation factor 3 OS=Saccharomyces cerevis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308599 ID=CX308599|Name=CX308599|organism=Citrus clementina|type=EST|length=351bp
AGTGGCGCTGCCTGAGGGAGTGGAGGCCAAGCTTATCAGTAATCTCAGCA
GCATTCATTGCATTTGGAAGATCCTGTTTGTTAGCAAATACAAGCAACAC
TGCATCTCGCAGCTCATCCTCATTCAACATCCTATGCAATTCATCCCTTG
CTTCTACAATACGGTCTCTGTCATTGCTGTCCACAACAAAAATGAGACCT
TGAGTGTTCTGGAAATAATGCCTCCACAAGGGACGAATCTTGTCCTGGCC
ACCAACATCCCACACAGTGAAACTGATGTTTTTATATTCAACGGTCTCCA
CATTAAACCCAATGGTAGGAATTGTGGTGACAATCTCTCCAAGCTTGAGC
T
back to top