CX308599

Overview
NameCX308599
Unique NameCX308599
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length351
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14605 contig Ccv1_Contig14605:197..547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARFF_DICDI (ADP-ribosylation factor F OS=Dictyostelium discoideum GN=arrF PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.248e-29
Identity = 61/117 (52.14%), Postives = 83/117 (70.94%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRML--NEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            LK G+++ TIPTIGFNVE +EYKN+S  VWD+GGQ+ IR LWR Y Q T   IFVVDS DR+R  E + E+  ++  N++E  +A LL+FANKQD+ N +  AE+ + L L+SL  +
Sbjct:   45 LKFGDVIRTIPTIGFNVEIIEYKNLSMNVWDIGGQNNIRALWRQYDQRTDVFIFVVDSTDRERFDEVKQEIKNIIEQNKNESSNASLLIFANKQDMLNPITPAELVNSLDLNSLTNK 161          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARFD_DICDI (ADP-ribosylation factor D OS=Dictyostelium discoideum GN=arrD PE=3 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 3.074e-28
Identity = 54/115 (46.96%), Postives = 85/115 (73.91%), Query Frame = -3
Query:    5 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 349
            L L E+V+TI T+G+NVET+++K+++ T+WD+ G+++IR LW+ ++     +IFVVDS+DR RI EA  EL +++ E+EL+   LL+FA KQD  + M   E+TD+LGLH ++ R
Sbjct:   37 LMLNEVVSTISTLGYNVETIQHKHLNLTLWDLAGEERIRTLWKPFYNKCTAIIFVVDSSDRLRIDEAASELAKLMKEEELKGCSLLIFATKQDCISPMEIPELTDQLGLHDIKDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL2_BOVIN (ADP-ribosylation factor-like protein 2 OS=Bos taurus GN=ARL2 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.399e-27
Identity = 56/114 (49.12%), Postives = 80/114 (70.18%), Query Frame = -3
Query:    2 GEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 340
            GE + TI PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A+++  I + L L S+R  H
Sbjct:   38 GEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQNLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHH 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL2_RAT (ADP-ribosylation factor-like protein 2 OS=Rattus norvegicus GN=Arl2 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.439e-27
Identity = 57/114 (50.00%), Postives = 79/114 (69.30%), Query Frame = -3
Query:    2 GEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 340
            GE V TI PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A++   I + L L S+R  H
Sbjct:   38 GEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHH 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL2_MOUSE (ADP-ribosylation factor-like protein 2 OS=Mus musculus GN=Arl2 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.439e-27
Identity = 57/114 (50.00%), Postives = 79/114 (69.30%), Query Frame = -3
Query:    2 GEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 340
            GE V TI PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A++   I + L L S+R  H
Sbjct:   38 GEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHH 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL2_HUMAN (ADP-ribosylation factor-like protein 2 OS=Homo sapiens GN=ARL2 PE=1 SV=4)

HSP 1 Score: 119.398 bits (298), Expect = 5.797e-27
Identity = 56/114 (49.12%), Postives = 80/114 (70.18%), Query Frame = -3
Query:    2 GEIVTTI-PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 340
            GE + TI PT+GFN++T+E++     +WDVGGQ  +R  WR+YF++T GLI+VVDS DR R+ + + EL  +L E+ L  A LL+FANKQDLP A+++  I + L L S+R  H
Sbjct:   38 GEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHH 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL4C_MOUSE (ADP-ribosylation factor-like protein 4C OS=Mus musculus GN=Arl4c PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.203e-26
Identity = 60/117 (51.28%), Postives = 77/117 (65.81%), Query Frame = -3
Query:   14 LKLGEIVTTIPTIGFNVETVEYKN-----ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL 349
            LK  E V T+PTIGFN E ++  N     IS   WDVGGQ+K+RPLW+ Y + T G+I+VVDS D DR+ EA+ ELH++    E +   LLV ANKQDLP ++  AEI  +L LH L
Sbjct:   33 LKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHEL 149          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL4C_HUMAN (ADP-ribosylation factor-like protein 4C OS=Homo sapiens GN=ARL4C PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.203e-26
Identity = 60/117 (51.28%), Postives = 77/117 (65.81%), Query Frame = -3
Query:   14 LKLGEIVTTIPTIGFNVETVEYKN-----ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSL 349
            LK  E V T+PTIGFN E ++  N     IS   WDVGGQ+K+RPLW+ Y + T G+I+VVDS D DR+ EA+ ELH++    E +   LLV ANKQDLP ++  AEI  +L LH L
Sbjct:   33 LKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHEL 149          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5B_MOUSE (ADP-ribosylation factor-like protein 5B OS=Mus musculus GN=Arl5b PE=2 SV=3)

HSP 1 Score: 116.701 bits (291), Expect = 3.758e-26
Identity = 54/111 (48.65%), Postives = 77/111 (69.37%), Query Frame = -3
Query:   11 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 343
            + E+V T PTIG NVE +  KN  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   ++EL+RML  ++LR A +L+FANKQD+   M AAEI+  L L S++
Sbjct:   38 MNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIK 148          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5B_HUMAN (ADP-ribosylation factor-like protein 5B OS=Homo sapiens GN=ARL5B PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.758e-26
Identity = 54/111 (48.65%), Postives = 77/111 (69.37%), Query Frame = -3
Query:   11 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 343
            + E+V T PTIG NVE +  KN  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+R+   ++EL+RML  ++LR A +L+FANKQD+   M AAEI+  L L S++
Sbjct:   38 MNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRSSWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIK 148          
The following BLAST results are available for this feature:
BLAST of CX308599 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 212
Match NameE-valueIdentityDescription
ARFF_DICDI1.248e-2952.14ADP-ribosylation factor F OS=Dictyostelium discoid... [more]
ARFD_DICDI3.074e-2846.96ADP-ribosylation factor D OS=Dictyostelium discoid... [more]
ARL2_BOVIN3.399e-2749.12ADP-ribosylation factor-like protein 2 OS=Bos taur... [more]
ARL2_RAT4.439e-2750.00ADP-ribosylation factor-like protein 2 OS=Rattus n... [more]
ARL2_MOUSE4.439e-2750.00ADP-ribosylation factor-like protein 2 OS=Mus musc... [more]
ARL2_HUMAN5.797e-2749.12ADP-ribosylation factor-like protein 2 OS=Homo sap... [more]
ARL4C_MOUSE2.203e-2651.28ADP-ribosylation factor-like protein 4C OS=Mus mus... [more]
ARL4C_HUMAN2.203e-2651.28ADP-ribosylation factor-like protein 4C OS=Homo sa... [more]
ARL5B_MOUSE3.758e-2648.65ADP-ribosylation factor-like protein 5B OS=Mus mus... [more]
ARL5B_HUMAN3.758e-2648.65ADP-ribosylation factor-like protein 5B OS=Homo sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308599 ID=CX308599|Name=CX308599|organism=Citrus clementina|type=EST|length=351bp
AGTGGCGCTGCCTGAGGGAGTGGAGGCCAAGCTTATCAGTAATCTCAGCA
GCATTCATTGCATTTGGAAGATCCTGTTTGTTAGCAAATACAAGCAACAC
TGCATCTCGCAGCTCATCCTCATTCAACATCCTATGCAATTCATCCCTTG
CTTCTACAATACGGTCTCTGTCATTGCTGTCCACAACAAAAATGAGACCT
TGAGTGTTCTGGAAATAATGCCTCCACAAGGGACGAATCTTGTCCTGGCC
ACCAACATCCCACACAGTGAAACTGATGTTTTTATATTCAACGGTCTCCA
CATTAAACCCAATGGTAGGAATTGTGGTGACAATCTCTCCAAGCTTGAGC
T
back to top