CX308599

Overview
NameCX308599
Unique NameCX308599
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length351
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14605 contig Ccv1_Contig14605:197..547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5_CAEEL (ADP-ribosylation factor-like protein 5 OS=Caenorhabditis elegans GN=arl-5 PE=2 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 4.908e-26
Identity = 54/107 (50.47%), Postives = 74/107 (69.16%), Query Frame = -3
Query:   11 VTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 331
            V T PTIG NVE V Y+N+ F +WD+GGQ+ +R  W  Y+  T  +I V+DS+D  RI   +++LH ML  ++L  A +LV ANKQDLP AMN AE++ +LGL +LR
Sbjct:   43 VETKPTIGSNVEEVSYRNLDFVIWDIGGQESLRKSWSTYYVQTDVVIVVIDSSDTTRIPIMKEQLHNMLQHEDLARAHILVLANKQDLPGAMNPAEVSTQLGLQTLR 149          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5_DICDI (ADP-ribosylation factor-like protein 5 OS=Dictyostelium discoideum GN=arl5 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.410e-26
Identity = 51/113 (45.13%), Postives = 79/113 (69.91%), Query Frame = -3
Query:   11 LKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 349
            L L E+V+T PT+G N+E   Y+NI   +WD+GGQD +R  W  Y+ NTQ +I V+DS DR R+   ++EL +ML  + L+ +++L++ANKQDL +AM+  E++  L LHS++
Sbjct:   40 LLLDEVVSTTPTVGSNLEEFVYRNIRLLMWDLGGQDLLRSTWNQYYINTQAVILVIDSTDRARVNLIKEELFKMLAHENLKKSIILIYANKQDLKDAMSPTELSTLLSLHSIK 152          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5A_MOUSE (ADP-ribosylation factor-like protein 5A OS=Mus musculus GN=Arl5a PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.410e-26
Identity = 55/111 (49.55%), Postives = 76/111 (68.47%), Query Frame = -3
Query:   11 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 343
            + E+V T PTIG NVE +   N  F +WD+GGQ+ +RP W  Y+ NT+ +I VVDS DR+RI   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++
Sbjct:   38 MNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRPSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIK 148          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL3_DANRE (ADP-ribosylation factor-like protein 3 OS=Danio rerio GN=arl3 PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 8.371e-26
Identity = 55/111 (49.55%), Postives = 75/111 (67.57%), Query Frame = -3
Query:    5 EIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 337
            +I    PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +LVFANKQDL  A  A+EI + L LH++R R
Sbjct:   41 DITHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLVFANKQDLLTAAPASEIAEGLNLHTIRDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL2_CAEEL (ADP-ribosylation factor-like protein 2 OS=Caenorhabditis elegans GN=evl-20 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 8.371e-26
Identity = 50/109 (45.87%), Postives = 76/109 (69.72%), Query Frame = -3
Query:    2 TTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH 328
            T  PT+GF+++TV +K+    +WDVGGQ  +R  W++YF++T  LI+VVDS+DR+R+++  +EL ++L E+ L  A LLV ANK DLP A++   I   L LHS++  H
Sbjct:   43 TIEPTLGFDIKTVHFKDFQLNLWDVGGQKSLRSYWKNYFESTDALIWVVDSSDRERLLQCSEELKKLLGEERLAGASLLVLANKSDLPGAIDVNSIAQVLDLHSIKSHH 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL3_XENLA (ADP-ribosylation factor-like protein 3 OS=Xenopus laevis GN=arl3 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.865e-25
Identity = 53/105 (50.48%), Postives = 73/105 (69.52%), Query Frame = -3
Query:    5 PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 319
            PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +L+FANKQDL  A  A+EI + L LH++R R
Sbjct:   47 PTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDVLIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL3_TAEGU (ADP-ribosylation factor-like protein 3 OS=Taeniopygia guttata GN=ARL3 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.436e-25
Identity = 53/105 (50.48%), Postives = 73/105 (69.52%), Query Frame = -3
Query:    5 PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 319
            PT GFN+++V+ +     VWD+GGQ KIRP WR+YF+NT  LI+V+DS DR R  E   EL  +L+E++L    +L+FANKQDL  A  A+EI + L LH++R R
Sbjct:   47 PTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVIDSADRKRFEETGQELAELLDEEKLSGVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL3_RAT (ADP-ribosylation factor-like protein 3 OS=Rattus norvegicus GN=Arl3 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 3.181e-25
Identity = 55/105 (52.38%), Postives = 71/105 (67.62%), Query Frame = -3
Query:    5 PTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQR 319
            PT GFN+++V+ +     VWD+GGQ KIRP WR YF+NT  LI+V+DS DR R  E   EL  +L E++L    +LVFANKQDL  A  AAEI + L LH++R R
Sbjct:   47 PTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLVFANKQDLLTAAPAAEIAEGLNLHTIRDR 151          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL14_HUMAN (ADP-ribosylation factor-like protein 14 OS=Homo sapiens GN=ARL14 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.181e-25
Identity = 51/105 (48.57%), Postives = 77/105 (73.33%), Query Frame = -3
Query:   38 LKLGEIVTTIPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEIT 349
            LKL + +TTIPTIGFNVE +E  +N S TVWDVGGQ+K+R +W  Y +NT GL++VVDS D+ R+ E++ +   +L  + +++  +++ ANKQD+P A+ A +IT
Sbjct:   33 LKLAKDITTIPTIGFNVEMIELERNFSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDIT 137          
BLAST of CX308599 vs. ExPASy Swiss-Prot
Match: ARL5A_RAT (ADP-ribosylation factor-like protein 5A OS=Rattus norvegicus GN=Arl5a PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.426e-25
Identity = 54/111 (48.65%), Postives = 75/111 (67.57%), Query Frame = -3
Query:   11 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR 343
            + E+V T PTIG NVE +   N  F +WD+GGQ+ +R  W  Y+ NT+ +I VVDS DR+RI   R+EL++ML  ++LR A LL+FANKQD+   M  AEI+  L L S++
Sbjct:   38 MNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIK 148          
The following BLAST results are available for this feature:
BLAST of CX308599 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 212
Match NameE-valueIdentityDescription
ARL5_CAEEL4.908e-2650.47ADP-ribosylation factor-like protein 5 OS=Caenorha... [more]
ARL5_DICDI6.410e-2645.13ADP-ribosylation factor-like protein 5 OS=Dictyost... [more]
ARL5A_MOUSE6.410e-2649.55ADP-ribosylation factor-like protein 5A OS=Mus mus... [more]
ARL3_DANRE8.371e-2649.55ADP-ribosylation factor-like protein 3 OS=Danio re... [more]
ARL2_CAEEL8.371e-2645.87ADP-ribosylation factor-like protein 2 OS=Caenorha... [more]
ARL3_XENLA1.865e-2550.48ADP-ribosylation factor-like protein 3 OS=Xenopus ... [more]
ARL3_TAEGU2.436e-2550.48ADP-ribosylation factor-like protein 3 OS=Taeniopy... [more]
ARL3_RAT3.181e-2552.38ADP-ribosylation factor-like protein 3 OS=Rattus n... [more]
ARL14_HUMAN3.181e-2548.57ADP-ribosylation factor-like protein 14 OS=Homo sa... [more]
ARL5A_RAT5.426e-2548.65ADP-ribosylation factor-like protein 5A OS=Rattus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21001G02Rv AbsLeaSub1 Citrus clementina cDNA clone C21001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308599 ID=CX308599|Name=CX308599|organism=Citrus clementina|type=EST|length=351bp
AGTGGCGCTGCCTGAGGGAGTGGAGGCCAAGCTTATCAGTAATCTCAGCA
GCATTCATTGCATTTGGAAGATCCTGTTTGTTAGCAAATACAAGCAACAC
TGCATCTCGCAGCTCATCCTCATTCAACATCCTATGCAATTCATCCCTTG
CTTCTACAATACGGTCTCTGTCATTGCTGTCCACAACAAAAATGAGACCT
TGAGTGTTCTGGAAATAATGCCTCCACAAGGGACGAATCTTGTCCTGGCC
ACCAACATCCCACACAGTGAAACTGATGTTTTTATATTCAACGGTCTCCA
CATTAAACCCAATGGTAGGAATTGTGGTGACAATCTCTCCAAGCTTGAGC
T
back to top