CX308867

Overview
NameCX308867
Unique NameCX308867
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8171 contig Ccv1_Contig8171:886..1574. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: RPN7_YEAST (26S proteasome regulatory subunit RPN7 OS=Saccharomyces cerevisiae GN=RPN7 PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 1.346e-13
Identity = 47/161 (29.19%), Postives = 81/161 (50.31%), Query Frame = 1
Query:   19 QDVATYGGLCALASFDRAELKSKVIDNVNFRNFLEL---VPEVRVLINDFYSSRYASCLDYLGNLKANLLLDI-HLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTG 489
            + +ATY  +  L + +R +LKSKVID+    + +     +  +  L    Y+S YAS   YL    AN+L+   +L+ H +    ++R K   Q    + ++ L  MA+AF  SVA ++ +L   I + Q+   ID  N I+     D +NA +  +++ G
Sbjct:  247 ESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQG 407          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: PSMD6_ORYSJ (26S proteasome non-ATPase regulatory subunit 6 OS=Oryza sativa subsp. japonica GN=RPN7 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.488e-12
Identity = 43/152 (28.29%), Postives = 69/152 (45.39%), Query Frame = 1
Query:   34 YGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTG 489
            Y  L ++ S DR  LK+KV+D       +  VP +   +N  Y+ +Y S       L   + LD +L  H      ++R     Q+   + SV +  MA+AF  +V  I+ EL   I   ++  +ID    +L     D RNA +Q  ++ G
Sbjct:  222 YTVLTSVISLDRVSLKAKVVDAPEILAVIGKVPHLSEFLNSLYNCQYKSFFAAFSGLTEQIKLDRYLQPHFRYYMREVRTVVYSQFLESYKSVTMEAMASAFGVTVDFIDLELSRFIAAGKLHCKIDKVACVLETNRPDARNAFYQATIKQG 373          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: PSMD6_ARATH (Probable 26S proteasome non-ATPase regulatory subunit 6 OS=Arabidopsis thaliana GN=At4g24820 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.385e-12
Identity = 39/152 (25.66%), Postives = 67/152 (44.08%), Query Frame = 1
Query:   34 YGGLCALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTG 489
            Y  L ++ + DR  LK KV+D       L  +P +   +N  Y  +Y +       +   +  D +L+ H      ++R     Q+   + SV +  MA AF  SV  I++EL   I   ++  +ID    +L     D +NA +Q  ++ G
Sbjct:  220 YTVLTSIITLDRVSLKQKVVDAPEILTVLGKIPFLSEFLNSLYECQYKAFFSAFAGMAVQIKYDRYLYPHFRFYMREVRTVVYSQFLESYKSVTVEAMAKAFGVSVDFIDQELSRFIAAGKLHCKIDKVAGVLETNRPDAKNALYQATIKQG 371          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: PSMD6_DICDI (26S proteasome non-ATPase regulatory subunit 6 OS=Dictyostelium discoideum GN=psmD6 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.645e-11
Identity = 39/147 (26.53%), Postives = 73/147 (49.66%), Query Frame = 1
Query:   49 ALASFDRAELKSKVIDNVNFRNFLELVPEVRVLINDFYSSRYASCLDYLGNLKANLLLDIHLHDHVETLYDQIRNKALIQYTHPFVSVDLHMMANAFKTSVAGIEKELEALITDNQIQARIDSHNKILYARHADQRNATFQRVLQTG 489
            +L   DR  LK KVID+ +  + +   P+++ L+  FY+  YA+    L +   ++  D +L +H      ++R  A  Q+   + SV L  M+N F  S   I++EL   +   ++  +ID  + ++    +D +N  ++  LQ G
Sbjct:  220 SLLHLDRVSLKQKVIDSPDVLSVINDTPKLQDLLQSFYNGDYANFFGALAHFSDSIKGDRYLAEHSRFFTREMRILAYNQFLESYSSVKLESMSNQFGVSYDFIDRELSRFVAAGRLNCKIDKVSGVIETTRSDAKNHLYKTTLQQG 366          
BLAST of CX308867 vs. ExPASy Swiss-Prot
Match: CSN1_BRAOL (COP9 signalosome complex subunit 1 (Fragment) OS=Brassica oleracea GN=CSN1 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.806e-11
Identity = 35/37 (94.59%), Postives = 36/37 (97.30%), Query Frame = 1
Query:  367 ELEAL-ITDNQIQARIDSHNKILYARHADQRNATFQR 474
            ELEAL ITDNQIQARIDSHNKILYARHADQRNATFQ+
Sbjct:    1 ELEALLITDNQIQARIDSHNKILYARHADQRNATFQK 37          
The following BLAST results are available for this feature:
BLAST of CX308867 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
RPN7_YEAST1.346e-1329.1926S proteasome regulatory subunit RPN7 OS=Saccharo... [more]
PSMD6_ORYSJ1.488e-1228.2926S proteasome non-ATPase regulatory subunit 6 OS=... [more]
PSMD6_ARATH7.385e-1225.66Probable 26S proteasome non-ATPase regulatory subu... [more]
PSMD6_DICDI1.645e-1126.5326S proteasome non-ATPase regulatory subunit 6 OS=... [more]
CSN1_BRAOL2.806e-1194.59COP9 signalosome complex subunit 1 (Fragment) OS=B... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC21004G06Rv AbsLeaSub1 Citrus clementina cDNA clone C21004G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308867 ID=CX308867|Name=CX308867|organism=Citrus clementina|type=EST|length=689bp
GCGGGGGTGATTGCTGCTCAAGATGTTGCAACATACGGGGGACTTTGTGC
ACTTGCAAGTTTTGATCGGGCTGAGCTTAAGAGCAAAGTTATAGATAATG
TCAACTTCCGAAATTTCTTAGAGCTGGTTCCTGAAGTTAGGGTGCTTATT
AACGATTTCTACTCTAGCCGTTATGCATCATGTCTGGATTACCTTGGAAA
TCTTAAGGCAAACCTGTTGCTTGATATCCATTTGCACGACCATGTTGAGA
CGTTGTATGATCAAATACGTAACAAAGCCCTCATCCAGTATACACACCCA
TTTGTGTCTGTTGATTTGCACATGATGGCAAATGCTTTCAAAACAAGTGT
TGCTGGGATAGAGAAAGAGCTTGAAGCCTTGATTACTGACAACCAAATAC
AGGCTCGGATTGACTCACACAACAAGATTTTGTATGCACGACATGCGGAT
CAAAGAAATGCAACTTTCCAACGGGTTTTACAGACTGGCAGTGAATTTGA
TCAGGATGTGAGGGTAATGTTACTGAGGGCAAATCTTCTGAAGCATGAAT
ACAATGTTAGGGCTGCTAGGAAACTTTGAATAGGTAGATCTGCTTGCTTA
GATTCAATTTTACCTGCCGTTGTCTACTACTATTATTGAAGAAGAAGGGT
TCTACGTTATTTTGAAAGAAGATGGTTGTCCATGGTTGA
back to top