FC875261

Overview
NameFC875261
Unique NameFC875261
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length724
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14223 contig Ccv1_Contig14223:7..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.524e-45
Identity = 105/190 (55.26%), Postives = 131/190 (68.95%), Query Frame = 1
Query:  118 SVVAARVTGIR-KSGVYQFSSVK--YLPGTLQRNVSLSVRCMAKNEQQKDQ-----------STQPP-----KLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXXPLFKGVSVESKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 630
            S+++  +T I  +S V QF+++   Y+P TL+RNVSL VR MA+ E ++             ST  P     + P++STKFSD+ AFSGPAPERINGRLAMIGFVAA+ VE++KGQ +  QLS GGVAWFLGT          P F+GVSVESKS   M+SDAE WNGR AM+GLVALA TEFVKG++LV
Sbjct:    8 SIMSNSMTNISSRSRVNQFTNIPSVYIP-TLRRNVSLKVRSMAEGEPKEQSKVAVDPTTPTASTPTPQPAYTRPPKMSTKFSDLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFVKGTSLV 196          
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 2.572e-34
Identity = 78/157 (49.68%), Postives = 106/157 (67.52%), Query Frame = 1
Query:  199 LQRNVSLSVRCMAKN------EQQKDQSTQP------PKLPRISTKFS-DVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXXPLFKGVSVESKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 630
            ++RN   +VR M ++      +QQK Q T        P    ++TK + D+F+F G APERINGR AMIGFVAA+ VEL+ G+DVF+Q+ +GGV WFL T          P+++G+S E+K++GF  SDAE+WNGRFAM+GLVALA TE+VKG  L+
Sbjct:   41 MRRNAKFTVRSMREDNEKEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTVDLFSFDGLAPERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYVKGGPLI 197          
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: ELI9_HORVU (Low molecular mass early light-inducible protein HV90, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.253e-30
Identity = 78/185 (42.16%), Postives = 102/185 (55.14%), Query Frame = 1
Query:   79 MAASLATQSMLGSSVVAARVTGIRKSGVYQFSSVKYLPGTLQRNVSLSVRCMAKNEQQKDQSTQPPKLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDG-GVAWFLGTXXXXXXXXXXPLFKGVSVESKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 630
            MA  ++  S  G++VV        +S    F + + LP       +L  R +    Q +  S  PP  P+ ST   D  AFSGPAPERINGRLAM+GFV ALAVE  +G  + +QL  G G AWF  T          PL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G+  +
Sbjct:    1 MATMMSMSSFAGAAVVP-------RSSASSFGA-RSLP-------ALGRRALVVRAQTEGPSAPPPNKPKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFI 170          
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: ELI6_HORVU (Low molecular mass early light-inducible protein HV60, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 2.253e-30
Identity = 71/156 (45.51%), Postives = 92/156 (58.97%), Query Frame = 1
Query:  169 FSSVKYLP-GTLQRNVSLSVRCMAKNEQQKDQSTQPPKLPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDG-GVAWFLGTXXXXXXXXXXPLFKGVSVESKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 630
            F+    LP G+ +   +L  R +    Q +  +  PP  P+ ST   D  AFSGPAPERINGRLAM+GFV ALAVE  +G  + +QL  G G AWF  T          PL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G+  +
Sbjct:   10 FAGAAVLPRGSARSLPALGRRTLVVRAQTEGPNAPPPNKPKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVALAATEIITGTPFI 165          
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 3.254e-29
Identity = 70/129 (54.26%), Postives = 85/129 (65.89%), Query Frame = 1
Query:  265 TQPPKLPRISTKFS-----DVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLS--DGGVAWFLGTXXXXXXXXXXPLFKGVSVESKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 630
            T  P  P+  TK +     D  AFSGPAPERINGRLAM+GFVAAL+VE ++G  +  Q+     G+AWFL T          PL +G SVESKS G  ++DAELWNGRFAM+GLVALA TEF+ G+  V
Sbjct:  101 TTIPAAPKPVTKKANPSVWDALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFV 229          
BLAST of FC875261 vs. ExPASy Swiss-Prot
Match: CBR_DUNBA (Carotene biosynthesis-related protein CBR, chloroplastic OS=Dunaliella bardawil GN=CBR PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.264e-14
Identity = 61/162 (37.65%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  172 SSVKYLPGTLQRNVSLSVRCMAKNEQQKDQSTQPPKLPR--------ISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXXPLFKGVSVESKSD--GFMTSDAELWNGRFAMMGLVALAVTEFVKGSTL 627
            +S+   P  L R  +    C      + + ST PP  P          +   ++V  FSG APE INGRLAM+GFVAAL  ELS G+ V  QL D      L T          P F       K D  G  T DAE+ NGRFAM+G  A+ V E ++G  L
Sbjct:   16 ASINVRPAPLLRTAAPKRVCKHIVRAENNPSTPPPSSPSPPPPPPTPAAPTVTEVMGFSG-APEIINGRLAMLGFVAALGAELSTGESVLTQLGDQPTLIAL-TFVLFSAASLIPAF----ARRKGDAMGPFTPDAEMTNGRFAMIGFAAMLVYEGIQGIAL 171          
The following BLAST results are available for this feature:
BLAST of FC875261 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ELI_PEA5.524e-4555.26Early light-induced protein, chloroplastic OS=Pisu... [more]
DS22_CRAPL2.572e-3449.68Desiccation stress protein DSP-22, chloroplastic O... [more]
ELI9_HORVU2.253e-3042.16Low molecular mass early light-inducible protein H... [more]
ELI6_HORVU2.253e-3045.51Low molecular mass early light-inducible protein H... [more]
ELI5_HORVU3.254e-2954.26High molecular mass early light-inducible protein ... [more]
CBR_DUNBA2.264e-1437.65Carotene biosynthesis-related protein CBR, chlorop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31402A04EF CTVClemen1 Citrus clementina cDNA clone C31402A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875261 ID=FC875261|Name=FC875261|organism=Citrus clementina|type=EST|length=724bp
GAAAATTGCAAGTAAGGAGCCCATTAACCTAAAAACTCCCAGTTGCTAAA
TTATTCCTCCGTTGCATAATCTACAAAAATGGCTGCTTCACTCGCCACTC
AATCTATGCTTGGAAGCTCTGTCGTCGCAGCTCGTGTTACCGGCATCAGG
AAATCTGGGGTGTACCAATTTTCCTCTGTTAAGTACTTACCTGGTACTCT
GCAGAGAAATGTTAGCTTATCAGTGCGCTGCATGGCTAAGAATGAGCAGC
AGAAGGATCAATCAACTCAGCCACCAAAGCTACCGCGTATAAGCACGAAG
TTCTCTGACGTGTTTGCGTTCAGCGGGCCGGCACCGGAGAGGATAAACGG
GAGGCTTGCGATGATTGGGTTCGTGGCTGCATTGGCGGTGGAGCTATCCA
AGGGTCAGGATGTGTTTGCCCAGTTATCAGACGGTGGAGTTGCCTGGTTC
TTGGGGACCAGTGTTCTGCTTTCGGTTGCGTCCCTGGTTCCTTTGTTTAA
AGGTGTCAGCGTGGAGTCTAAATCGGATGGGTTCATGACTTCGGATGCTG
AGTTGTGGAATGGGAGGTTCGCTATGATGGGTCTTGTTGCTTTGGCTGTC
ACTGAGTTTGTTAAAGGCAGTACCCTTGTTTAGTTAAGTCCAATTTTCCA
GTGATATGCGGACTGCAGAGTCTTGAAATGATAACAAGACCCTATTCTTA
TACTTGAAGCGCACGTCATGTTTC
back to top