FC875262

Overview
NameFC875262
Unique NameFC875262
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig7777 contig Ccv1_Contig7777:844..1575. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.385e-35
Identity = 82/197 (41.62%), Postives = 120/197 (60.91%), Query Frame = 2
Query:   56 TAISFLVLTFATKP-LVGLAD----PLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYD-KTSIINEDVDLNVRFST--ETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN 616
            TA+  L+  F +K    G+A+    P++D +G++++    YY++S+I GAGG GL L R   + CP  VVQ  SD + GT + FS  D K  ++    D+N+ F    +  C+  TVWR+D+YD S GKW++TT GV+G PG  TL +WFK E+ G     YK   CPSVC+SC +LC+D+G    +D   RLAL++
Sbjct:    5 TAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAG--VLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSD 199          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 130.954 bits (328), Expect = 6.659e-30
Identity = 79/201 (39.30%), Postives = 111/201 (55.22%), Query Frame = 2
Query:   50 FVTAISFLVLTFATKPLVGLAD----PLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNE---LCPLDVVQLSSDSERGTRLRFSMYD-KTSIINEDVDLNVRFSTETRCN--EPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDH--ARRLALTN 616
            FV+A+    L  A  PL+  AD    P++D++G K+    +YY+V  +R  GG GLT+         +CP  VVQ   + +    L F   + K  ++    DLN+ FS    C     TVWR+D YD S G++F+T GGV+GNPG +T+ +WFK E   G    YK+V CP+VC SC   C DVG+  D    RRLAL++
Sbjct:   13 FVSAL----LAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGG-GLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGS-GFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.710e-23
Identity = 70/172 (40.70%), Postives = 98/172 (56.98%), Query Frame = 2
Query:  116 PLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLF-RGRNELCPLDVVQLSSDSERGTRLRFSMYD--KTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSND--HARRLALTN 616
            P+VD++G  V    DY++VSAI GAGG GLT++  G  + CPL VVQ   D+  G  + FS     K +I+ E VDLNV+F+    CNE T W+VD + P    W +T GG +G  G ++  + FK ++  G   +YK   CPS   + +  CN+V +  D    RRL LTN
Sbjct:    5 PIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDN--GEPIIFSAIKNVKDNIVFESVDLNVKFNITINCNETTAWKVDRF-PGVIGWTVTLGGEKGYHGFESTHSMFKIKK-AGLPFSYKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTN 172          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.049e-19
Identity = 54/168 (32.14%), Postives = 90/168 (53.57%), Query Frame = 2
Query:  110 ADPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYDKT-SIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHARRLAL 610
            A+ + D+ G  V    +YY+VSAI GAGG G+   R R  +CP+ ++Q  SD + G  +RFS  +++   I  D +L + F  +  C E + W +       G+  +  GG E +P  + ++ +FK E++G     YK+V CP   +S    C+D+G++ +  R L L
Sbjct:    3 AEKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVEKPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLGS--LAYKLVFCP---KSSSGSCSDIGINYEGRRSLVL 162          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 5.122e-14
Identity = 56/184 (30.43%), Postives = 88/184 (47.83%), Query Frame = 2
Query:  110 ADPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPL--DVVQLSSD-SERGTRLRF----SMYDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHA-RRLALTNGRALAVV 637
            A P++DV G ++++   Y ++S   GA G  + L +  N   P    + + +SD    GT +RF    S + +    NE +++    ST   C   T+W+V  YD S G   + TGG  G    Q   +WFK   +   +  Y +++CP    S    C+ VGV + +  RRLAL N   L V+
Sbjct:    5 ATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG----QADSSWFKI--VKSSQLGYNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALVNENPLDVL 182          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: IFXA_BAUUN (Factor Xa inhibitor BuXI OS=Bauhinia ungulata PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.320e-13
Identity = 51/184 (27.72%), Postives = 84/184 (45.65%), Query Frame = 2
Query:  113 DPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYDKTSIINEDVDLNVRFSTETRCN-EPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHARRLALTNGRALAVVLVPGNERS 661
            D ++D +G  V     YY++ A RG GG GL L R   E CP  VVQ SS+   G  +  +   +T  I+    ++++F     C  +P+ W +       G   +           +     F+ E++  D   YK++HCPS  +SC  L   + +  ++ RRL + +G+ L V     N+ S
Sbjct:    1 DIVLDTDGKPVNNGGQYYIIPAFRGNGG-GLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVD--------ERFPLEFRIEKVSED--AYKLMHCPSSSDSCRDL--GIAIDEENNRRLVVRDGKPLLVRFKEANQDS 171          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: ITRY_BAUVA (Trypsin inhibitor BvTI OS=Bauhinia variegata PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.397e-13
Identity = 57/186 (30.65%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  113 DPLVDVNGNKVEASRD-YYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHA--RRLALTNGRALAVVLVPGNERS 661
            D L+D +G  V  +   YY++ A RG GG GLTL R  +E CP  VVQ SS+   G  +  S   ++  I+    + ++F   T   +P+ W +              G V+     +     F+ ER+  D  TYK++HC S  +S    C D+G+S D    RRL + +   L V     N+ S
Sbjct:    1 DTLLDTDGEVVRNNGGPYYIIPAFRGNGG-GLTLTRVGSETCPRTVVQASSEHSDGLPVVISALPRSLFISTSWRVTIQFVEATCIPKPSFWHIPQDSE-------LEGAVKVGASDERFPLEFRIERVSED--TYKLMHCSSTSDS----CRDLGISIDEEGNRRLVVRDENPLLVRFKKANQDS 172          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: PIP22_PEA (Kunitz-type trypsin inhibitor-like 2 protein OS=Pisum sativum GN=PIP20-2 PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.262e-12
Identity = 62/208 (29.81%), Postives = 94/208 (45.19%), Query Frame = 2
Query:   62 ISFLVLTFATKPLVGLA----DPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMYD-KTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVG-VSNDHA-RRLALTNGRALAVVLVPGNERSA 664
            +SFL+  F T   +  +    + ++DVNG  +     YY++ AIRG  G G+ L R  +  CP+ V+Q   + + G  ++F +      II     + + ++ +  C + + W V   D    K  +  GG E  PG QTL   FK E+       YK+  C     +C+    DVG   ND A RRL LT   +  VV V      A
Sbjct:    9 LSFLLFVFITTLSLAFSNEDVEQVLDVNGKPIFPGGQYYILPAIRGPPGGGVRLGRTGDLTCPVTVLQDRREVKNGLPVKFVIPGISPGIIFTGTPIEIEYTKKPNCAKSSKWLV-FVDNVIQKACVGIGGPENYPGIQTLSGLFKIEKHESGFG-YKLGFCIKGSPTCL----DVGRFDNDEAGRRLNLTEHESFQVVFVEAEANDA 210          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: IAAS_ORYSJ (Alpha-amylase/subtilisin inhibitor OS=Oryza sativa subsp. japonica GN=RASI PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.262e-12
Identity = 60/186 (32.26%), Postives = 90/186 (48.39%), Query Frame = 2
Query:   62 ISFLVLTFATKPLVGLADPLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMY-------DKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRATYKIVHCPSVCESCVSLCNDVGVSNDHAR 598
            +S L ++F+         P+ D  G+++ A   YY++ A  G GG GLT+   R   CPL V Q + +  +G  +RF+ +       D+T  I    D+ +RF+  T C + T W V   +P  G   + TG + G P     +N F+ E+ GG    YK+V       SC   C D+GVS D AR
Sbjct:   11 LSLLAISFSCS---AAPPPVYDTEGHELSADGSYYVLPASPGHGG-GLTM-APRVLPCPLLVAQETDERRKGFPVRFTPWGGAAAPEDRT--IRVSTDVRIRFNAATICVQSTEWHVGD-EPLTGARRVVTGPLIG-PSPSGRENAFRVEKYGGG---YKLV-------SCRDSCQDLGVSRDGAR 177          
BLAST of FC875262 vs. ExPASy Swiss-Prot
Match: IAAS_HORVU (Alpha-amylase/subtilisin inhibitor OS=Hordeum vulgare PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.152e-12
Identity = 51/162 (31.48%), Postives = 79/162 (48.77%), Query Frame = 2
Query:  116 PLVDVNGNKVEASRDYYLVSAIRGAGGSGLTLFRGRNELCPLDVVQLSSDSERGTRLRFSMY---DKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGGDRA-TYKIVHCPSVCESCVSLCNDVGVSND 589
            P+ D +G+++ A  +YY++SA R  GG GLT+  G    CPL V Q  +    G  +R + Y       II    D+ + F   T C + T W +DS + + G+  + TG V+ +P     +N F+ E+  G     YK++       SC   C D+GV  D
Sbjct:   27 PVHDTDGHELRADANYYVLSANRAHGG-GLTMAPGHGRHCPLFVSQDPNGQHDGFPVRITPYGVAPSDKIIRLSTDVRISFRAYTTCLQSTEWHIDS-ELAAGRRHVITGPVK-DPSPSGRENAFRIEKYSGAEVHEYKLM-------SCGDWCQDLGVFRD 178          
The following BLAST results are available for this feature:
BLAST of FC875262 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
ASP_THECC1.385e-3541.6221 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU6.659e-3039.30Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA2.710e-2340.70Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE4.049e-1932.14Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPI2_SOLTU5.122e-1430.43Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
IFXA_BAUUN3.320e-1327.72Factor Xa inhibitor BuXI OS=Bauhinia ungulata PE=1... [more]
ITRY_BAUVA7.397e-1330.65Trypsin inhibitor BvTI OS=Bauhinia variegata PE=1 ... [more]
PIP22_PEA1.262e-1229.81Kunitz-type trypsin inhibitor-like 2 protein OS=Pi... [more]
IAAS_ORYSJ1.262e-1232.26Alpha-amylase/subtilisin inhibitor OS=Oryza sativa... [more]
IAAS_HORVU2.152e-1231.48Alpha-amylase/subtilisin inhibitor OS=Hordeum vulg... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A05EF CTVClemen1 Citrus clementina cDNA clone C31402A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875262 ID=FC875262|Name=FC875262|organism=Citrus clementina|type=EST|length=732bp
AAGTACTCACTCAATCAGCTCTCTGAAAGATAACAAAATGAGTACTCCTT
TTGTAACTGCAATCTCCTTCCTTGTCCTTACCTTTGCCACAAAACCGCTT
GTGGGACTCGCTGATCCTTTGGTTGATGTCAATGGCAACAAGGTCGAAGC
ATCCCGAGACTACTATTTGGTCTCAGCAATTCGAGGAGCAGGCGGCAGCG
GCCTCACCCTCTTCAGGGGCAGAAACGAACTCTGCCCACTTGATGTTGTC
CAACTAAGTTCCGACTCAGAAAGAGGAACCCGTTTAAGATTCTCAATGTA
TGATAAAACTAGTATTATCAATGAAGATGTGGATCTGAACGTGAGATTCT
CGACAGAGACTCGCTGCAACGAACCAACAGTATGGAGAGTCGACAGCTAT
GATCCATCGAGAGGAAAATGGTTTATAACAACTGGTGGTGTTGAAGGAAA
CCCTGGAGCTCAAACTTTGAAAAACTGGTTTAAGTTTGAGAGAATTGGAG
GAGATCGAGCTACGTACAAGATTGTTCACTGTCCTTCCGTTTGCGAATCC
TGTGTATCTTTATGCAATGATGTTGGGGTTTCTAACGATCATGCTCGACG
TTTGGCTCTCACTAACGGGCGCGCGCTTGCTGTTGTTCTAGTCCCTGGTA
ATGAGAGATCAGCCTCATGTGCGTCTTGAATGCCCTTGTATCATTACTCT
AAATATGGATCGGGCTAGCTCCTGACGCTTAT
back to top