FC875268

Overview
NameFC875268
Unique NameFC875268
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length733
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10193 contig Ccv1_Contig10193:1..733. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: CA123_XENLA (UPF0587 protein C1orf123 homolog OS=Xenopus laevis PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 8.489e-25
Identity = 60/163 (36.81%), Postives = 95/163 (58.28%), Query Frame = 1
Query:   52 MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKF 534
            MV   L   A LENLT L+P G     +F +F KLKCG CGE+S K   ++L +++P +GG+G+ +++Q+CK C RE ++ ++     P   E +++  F  ++ F+CRG EP+DF    G+  E    GT + +I+L   D+ +YDEK    V I  +  +F
Sbjct:    1 MVKFALQFKASLENLTQLRPHG----EDFRWFLKLKCGNCGEVSDKWQYITLMDSVPLKGGRGSASMVQRCKLCSRENSIDILAASLHPYNAEDSET--FKTIVEFECRGLEPIDFQPQAGFAAEGAETGTPFHEINLQEKDWTDYDEKAKESVGIYEVEHRF 157          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: CA123_HUMAN (UPF0587 protein C1orf123 OS=Homo sapiens GN=C1orf123 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 3.226e-24
Identity = 59/158 (37.34%), Postives = 94/158 (59.49%), Query Frame = 1
Query:   67 LMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKF 534
            L + A LEN+TNL+P G     +F ++ K+KCG CGE+S K   + L +++  +GG+G+ +++QKCK C RE ++ ++    KP   E   +  F  ++ F+CRG EPVDF    G+  E + +GT + DI+L   D+ +YDEK    V I  +  +F
Sbjct:    6 LQLKATLENITNLRPVG----EDFRWYLKMKCGNCGEISDKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILSSTIKPYNAE--DNENFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTAFSDINLQEKDWTDYDEKAQESVGIYEVTHQF 157          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: CA123_BOVIN (UPF0587 protein C1orf123 homolog OS=Bos taurus PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.567e-23
Identity = 58/158 (36.71%), Postives = 95/158 (60.13%), Query Frame = 1
Query:   67 LMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKF 534
            L + A LEN+TNL+P G     +F ++ K+KCG CGE+S+K   + L +++  +GG+G+ +++QKCK C RE ++ ++    K  +  A  +  F  ++ F+CRG EPVDF    G+  E + +GT + DI+L   D+ +YDEK    V I  +  +F
Sbjct:    6 LQLKATLENVTNLRPVG----EDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASMVQKCKLCSRENSIEILSSTIK--SYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTVFSDINLQEKDWTDYDEKAQESVGIYEVTHQF 157          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: CA123_RAT (UPF0587 protein C1orf123 homolog OS=Rattus norvegicus PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 6.084e-23
Identity = 55/144 (38.19%), Postives = 90/144 (62.50%), Query Frame = 1
Query:   67 LMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEK 492
            L + A LEN+TNL+P G     +F ++ K+KCG CGE+S+K   + L +++  +GG+G+ +++QKCK C RE ++ ++    K  +  A  +  F  ++ F+CRG EPVDF    G+  E + +GT + DI+L   D+ +YDEK
Sbjct:    6 LQLKATLENVTNLRPVG----EDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIEILSSTIK--SYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAAEGVESGTVFSDINLQEKDWTDYDEK 143          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: CA123_MOUSE (UPF0587 protein C1orf123 homolog OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.946e-23
Identity = 57/158 (36.08%), Postives = 94/158 (59.49%), Query Frame = 1
Query:   67 LMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKF 534
            L + A LEN+TNL+P G     +F ++ K+KCG CGE+S+K   + L +++  +GG+G+ +++QKCK C RE ++ ++    K    E  +   F  ++ F+CRG EPVDF    G+  + + +GT + DI+L   D+ +YDEK    V I  +  +F
Sbjct:    6 LQLKATLENVTNLRPVG----EDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASMVQKCKLCARENSIDILSSTIKAYNAEDNEK--FKTIVEFECRGLEPVDFQPQAGFAADGVESGTVFSDINLQEKDWTDYDEKAQESVGIFEVTHQF 157          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: U587_DROME (UPF0587 protein CG4646 OS=Drosophila melanogaster GN=CG4646 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.312e-22
Identity = 65/168 (38.69%), Postives = 90/168 (53.57%), Query Frame = 1
Query:   52 MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTT-NLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLA-GTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKFEVVK 546
            MV   L ISA LEN+  L+       P++S+F KLKC  CGE S K   ++ +E +          N   KCK C RE ++ ++     P T  A  SG F  +++F+CRG EPV+F   VGW+V S   G Q+E++DLS  D+ EYD+K    V I     KF  +K
Sbjct:    1 MVRVGLQISATLENVDKLETS----HPDYSFFLKLKCSNCGEQSDKWHDITESERVQQDSRNAAGFNFFMKCKMCSRENSIDIVDKSNAPYT--ADDSGAFKTIVVFECRGAEPVEFSPRVGWRVSSAENGQQFEEVDLSEDDWVEYDQKNNNSVGIYEFASKFIKLK 162          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: U587_NEMVE (UPF0587 protein v1g245604 OS=Nematostella vectensis GN=v1g245604 PE=3 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.556e-21
Identity = 56/162 (34.57%), Postives = 91/162 (56.17%), Query Frame = 1
Query:   52 MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKC-GCGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLAGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKF 534
            MV   L + A+LEN+TNL+ +G     +F ++  LKC  CGE++++   + L E+ P +GG+G  + + KCK C RE +V ++     P    A+ +G F  ++ FDCRG EP DF    GW  E    +   ++DL+  D+++YDEK    V +  +  +F
Sbjct:    1 MVRIGLQLKANLENVTNLKAEG----EDFRWYLMLKCMNCGEVTKQWVYMCLMESQPVKGGRGYAHFVSKCKLCHRENSVDIMKDSIHPYL--ASHNGKFHTIVSFDCRGVEPTDFSPRTGWTAEGENTSTPFEVDLTEKDWSDYDEKAQNAVGVYGVTSQF 156          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: U587_DROPS (UPF0587 protein GA18326 OS=Drosophila pseudoobscura pseudoobscura GN=GA18326 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.691e-20
Identity = 65/169 (38.46%), Postives = 88/169 (52.07%), Query Frame = 1
Query:   52 MVNCMLMISADLENLTNLQPQGGCDDPNFSYFFKLKCG-CGELSQKETCVSLAETLPTQGGKGTT--NLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKV-ESLAGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKFEVVK 546
            MV   L ISA LEN+  L+       P++ +F KL C  CGE S K   ++ +E +  Q  + T   N   KCK C RE ++ ++     P T  A  SG    +++FDCRG EPVDF    GWKV  S  G  +ED+DLS  D+ EYD+K    V +     KF  +K
Sbjct:    1 MVRVGLQISATLENIDKLETS----HPDYPFFVKLTCSNCGEQSDKWHDITESERVQ-QDTRNTAGFNFFMKCKMCSRENSIDIVEKSNVPYT--ADDSGKLKTIVIFDCRGLEPVDFSPRSGWKVFSSENGQSFEDVDLSEDDWVEYDQKNNNSVGVYEFVSKFIKLK 162          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: U587_CAEEL (UPF0587 protein F46B6.12 OS=Caenorhabditis elegans GN=F46B6.12 PE=3 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 9.091e-19
Identity = 55/162 (33.95%), Postives = 86/162 (53.09%), Query Frame = 1
Query:   67 LMISADLENLTNLQPQGGCDDPNFSYFFKLKC-GCGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESL-AGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKFEVVK 546
            L +   L+ +T+L+P    D  +F +  KLKC  CGE       V L E L   G +G  NL++KCK CGR  T+T++    K    E  Q+  +  + +FDCRG EP DF     W  +S+  G  + +IDLS  ++ ++D+K +  V IS +  +F  ++
Sbjct:    6 LELKCQLKGITDLRPD---DTDSFHWHMKLKCTNCGEAPDHWQYVVLNEMLDVPGSRGEANLVEKCKLCGRVNTLTIVEDMFKSYNIE--QNEKWQQIAVFDCRGLEPFDFDPRDEWIAKSVETGNAFHEIDLSEKEWVDFDDKAMEAVEISEMSSQFTTIR 162          
BLAST of FC875268 vs. ExPASy Swiss-Prot
Match: U587_DICDI (UPF0587 protein OS=Dictyostelium discoideum GN=DDB_G0270194 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.832e-12
Identity = 48/167 (28.74%), Postives = 81/167 (48.50%), Query Frame = 1
Query:   52 MVNCMLMISADLENLTNLQPQGGCDDPNFSYFF-KLKCG-CGELSQKETCVSLAETLPTQGGKGTTNLIQKCKFCGREGTVTMIPGRGKPLTQEAAQSGGFSPLMLFDCRGYEPVDFVFGVGWKVESLAGTQYEDIDLSGGDYAEYDEKGVCPVMISNLRFKFEVVK 546
            MV   + + A+LE + N+ P        +  FF K+KC  CGE+  K   + L ++     GK   NL  KCK C RE ++ +        +    +S     +  FDCRG E  +F     W V S +G +Y+D+DL  G+++E++E+    + I ++    + +K
Sbjct:    1 MVRQSISLKAELEEIQNIFPA------TYKIFFLKIKCSNCGEIPDK--WIGLDKSNIEVIGKSNVNLATKCKGCNRENSIVI---EDTDYSSRTIESEKDFEIARFDCRGVEIEEFDPRDNWIVVSSSGKEYKDVDLEEGEWSEFEERTSTSLTILSIESSIKKIK 156          
The following BLAST results are available for this feature:
BLAST of FC875268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CA123_XENLA8.489e-2536.81UPF0587 protein C1orf123 homolog OS=Xenopus laevis... [more]
CA123_HUMAN3.226e-2437.34UPF0587 protein C1orf123 OS=Homo sapiens GN=C1orf1... [more]
CA123_BOVIN3.567e-2336.71UPF0587 protein C1orf123 homolog OS=Bos taurus PE=... [more]
CA123_RAT6.084e-2338.19UPF0587 protein C1orf123 homolog OS=Rattus norvegi... [more]
CA123_MOUSE7.946e-2336.08UPF0587 protein C1orf123 homolog OS=Mus musculus P... [more]
U587_DROME2.312e-2238.69UPF0587 protein CG4646 OS=Drosophila melanogaster ... [more]
U587_NEMVE2.556e-2134.57UPF0587 protein v1g245604 OS=Nematostella vectensi... [more]
U587_DROPS3.691e-2038.46UPF0587 protein GA18326 OS=Drosophila pseudoobscur... [more]
U587_CAEEL9.091e-1933.95UPF0587 protein F46B6.12 OS=Caenorhabditis elegans... [more]
U587_DICDI4.832e-1228.74UPF0587 protein OS=Dictyostelium discoideum GN=DDB... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A12EF CTVClemen1 Citrus clementina cDNA clone C31402A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875268 ID=FC875268|Name=FC875268|organism=Citrus clementina|type=EST|length=733bp
CACGCTGAAAAATAGAGAGAGAATATTTTGGCACTGGAAAGCTAAGCGAA
AATGGTGAATTGCATGCTGATGATCAGCGCCGATCTCGAGAACCTCACCA
ATCTCCAACCTCAAGGCGGCTGCGACGATCCTAACTTCTCTTACTTCTTC
AAGTTGAAGTGTGGATGCGGAGAACTAAGCCAGAAAGAAACTTGTGTGAG
CTTGGCTGAAACTCTTCCTACTCAAGGAGGCAAGGGAACCACAAATCTCA
TTCAAAAATGCAAATTTTGTGGGAGAGAAGGAACTGTTACTATGATCCCA
GGCCGGGGTAAACCATTGACCCAGGAAGCTGCTCAATCTGGCGGTTTTAG
CCCCTTGATGTTATTCGACTGCAGGGGTTATGAGCCTGTGGATTTCGTCT
TTGGTGTTGGATGGAAAGTTGAATCTCTTGCTGGGACTCAGTATGAAGAC
ATTGACTTGTCAGGAGGGGACTATGCCGAGTACGATGAGAAAGGAGTGTG
CCCGGTTATGATTTCCAACCTCCGCTTCAAGTTTGAAGTGGTGAAGCACT
GAAGTAAAGCTCTTCTCTTGGTACATACGCCCTAACTGTTCCTTGTGAAT
GAGGTAGAAACATTTGACTGGATTACATGTAGTATGCAATGTATGGGAGT
TGCTTGACGAAATATGTCTACTTCTGAATTACGTGCATAAGTGCTGTCAT
AACAGCAGTCAACTGGATAATGGCTCGCTAAAT
back to top