FC875272

Overview
NameFC875272
Unique NameFC875272
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875272_ssr47 microsatellite FC875272_ssr47:47..56. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875272_ssr58 microsatellite FC875272_ssr58:58..75. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_CHICK (RING finger protein 185 OS=Gallus gallus GN=RNF185 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.289e-19
Identity = 45/103 (43.69%), Postives = 61/103 (59.22%), Query Frame = 2
Query:  236 SIASAATGSENYNGCFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            S ++ A  + N +  F+CNICLD A D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   24 SSSNGAGDNTNQDNTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 112          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_RAT (RING finger protein 185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.539e-18
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  236 SIASAATGSENYNG-------CFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            S A   +GS N  G        F+CNICLD A D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   15 SSAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 110          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_MOUSE (RING finger protein 185 OS=Mus musculus GN=Rnf185 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.010e-18
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  236 SIASAATGSENYNG-------CFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            S A   +GS N  G        F+CNICLD A D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   15 SNAGGPSGSSNGTGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 110          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_PONAB (RING finger protein 185 OS=Pongo abelii GN=RNF185 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.625e-18
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  236 SIASAATGSENYNG-------CFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            S A   +GS N  G        F+CNICLD A D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   15 SSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 110          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_HUMAN (RING finger protein 185 OS=Homo sapiens GN=RNF185 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.625e-18
Identity = 48/110 (43.64%), Postives = 61/110 (55.45%), Query Frame = 2
Query:  236 SIASAATGSENYNG-------CFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            S A   +GS N  G        F+CNICLD A D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   15 SSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 110          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RNF5_HUMAN (E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens GN=RNF5 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.637e-18
Identity = 47/108 (43.52%), Postives = 63/108 (58.33%), Query Frame = 2
Query:  281 FDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP----PAFGNQALLYPTSNTG 592
            F+CNICL+ A + VV++CGHLYCWPC+++WL  +       E  +CPVCKA IS   +VPLYGRG    + +P  K        PPRP    PA  ++    P  +TG
Sbjct:   25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETR------PERQECPVCKAGISREKVVPLYGRGSQKPQ-DPRLKT-------PPRPQGQRPAPESRGGFQPFGDTG 118          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RN185_DANRE (RING finger protein 185 OS=Danio rerio GN=rnf185 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.637e-18
Identity = 43/101 (42.57%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  242 ASAATGSENYNGCFDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            A  + G    +  F+CNICLD + D V++LCGHL+CWPC+++WL  +           CPVCKA IS   ++PLYGRG T  + +P  K        PPRP
Sbjct:   26 AGESGGGGAQDSTFECNICLDTSKDAVISLCGHLFCWPCLHQWLETR------PNRQVCPVCKAGISRDKVIPLYGRGST-GQQDPREKT-------PPRP 112          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RNF5_RAT (E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.950e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  281 FDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            F+CNICL+ A + VV++CGHLYCWPC+++WL  +       +  +CPVCKA IS   +VPLYGRG    + +P  K        PPRP
Sbjct:   25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETR------PDRQECPVCKAGISREKVVPLYGRGSQKPQ-DPRLKT-------PPRP 98          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RNF5_MOUSE (E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 4.950e-17
Identity = 41/88 (46.59%), Postives = 55/88 (62.50%), Query Frame = 2
Query:  281 FDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            F+CNICL+ A + VV++CGHLYCWPC+++WL  +       +  +CPVCKA IS   +VPLYGRG    + +P  K        PPRP
Sbjct:   25 FECNICLETAREAVVSVCGHLYCWPCLHQWLETR------PDRQECPVCKAGISREKVVPLYGRGSQKPQ-DPRLKT-------PPRP 98          
BLAST of FC875272 vs. ExPASy Swiss-Prot
Match: RNF5_CAEEL (RING finger protein 5 OS=Caenorhabditis elegans GN=rnf-5 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 6.465e-17
Identity = 48/110 (43.64%), Postives = 62/110 (56.36%), Query Frame = 2
Query:  221 AREWKSIASAATGSENYNGC--FDCNICLDFAYDPVVTLCGHLYCWPCIYKWLHVQSASLASDEHPQCPVCKADISHTTMVPLYGRGQTPTESEPEGKVSHRGTVIPPRP 544
            A E K+ +   T S N +    F+CNICLD A D VV+LCGHL+CWPC+ +WL  +        +  CPVCK+ I    +VP+YGRG     S+P  KV       PPRP
Sbjct:    2 ASETKAPSEEPTSSSNKDESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTR------PNNQVCPVCKSAIDGNKVVPIYGRG--GDSSDPRKKV-------PPRP 96          
The following BLAST results are available for this feature:
BLAST of FC875272 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
RN185_CHICK5.289e-1943.69RING finger protein 185 OS=Gallus gallus GN=RNF185... [more]
RN185_RAT1.539e-1843.64RING finger protein 185 OS=Rattus norvegicus GN=Rn... [more]
RN185_MOUSE2.010e-1843.64RING finger protein 185 OS=Mus musculus GN=Rnf185 ... [more]
RN185_PONAB2.625e-1843.64RING finger protein 185 OS=Pongo abelii GN=RNF185 ... [more]
RN185_HUMAN2.625e-1843.64RING finger protein 185 OS=Homo sapiens GN=RNF185 ... [more]
RNF5_HUMAN7.637e-1843.52E3 ubiquitin-protein ligase RNF5 OS=Homo sapiens G... [more]
RN185_DANRE7.637e-1842.57RING finger protein 185 OS=Danio rerio GN=rnf185 P... [more]
RNF5_RAT4.950e-1746.59E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegi... [more]
RNF5_MOUSE4.950e-1746.59E3 ubiquitin-protein ligase RNF5 OS=Mus musculus G... [more]
RNF5_CAEEL6.465e-1743.64RING finger protein 5 OS=Caenorhabditis elegans GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31402B04EF CTVClemen1 Citrus clementina cDNA clone C31402B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875272 ID=FC875272|Name=FC875272|organism=Citrus clementina|type=EST|length=732bp
GATCGTCATCGACATCCTAACCTCACTCCCTTCTGTCTTCTCTTTACTCT
CTCTCTCCTCTCTCTCTCTCTCTCTCCCTCTCCCTCTCTTCAAATCGCTG
AAACTCTTCTCAGAGCAGAAGCCTCGGGACGCGCCGTTTTTGTCTGCCTT
CGAGTCAAAAGGCATACTGGTAGTTGTTGCAACTTGTGCAAATAAATTCA
TGGCCTTTGAGCAATACTTTGCCCGCGAATGGAAGTCCATTGCTAGTGCA
GCCACAGGCTCAGAAAATTACAATGGTTGCTTCGATTGTAACATCTGCTT
GGACTTTGCCTACGACCCGGTGGTCACCTTGTGTGGCCATCTCTACTGCT
GGCCCTGCATCTACAAGTGGCTCCATGTTCAAAGTGCCTCTCTTGCCTCT
GATGAGCATCCACAATGTCCGGTATGCAAGGCTGATATTTCACATACAAC
AATGGTACCCCTCTATGGTCGGGGTCAAACTCCAACTGAATCTGAGCCAG
AAGGCAAGGTTTCTCACCGAGGTACGGTCATACCTCCAAGGCCTCCAGCC
TTTGGCAACCAAGCTCTTCTATATCCTACATCCAATACTGGCCAACAGCT
TCCTTATCGTAATCCTTATCAGAGTCAAAACTATGATCCTCATGGACAAC
ATTCATATGGCGGTTTTGAAGGGAATTCTCCATCTCCCACTGCTCATCTT
GGANGCACTGCATTGTCTGGATTTCAGCATCC
back to top