FC875275

Overview
NameFC875275
Unique NameFC875275
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length739
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875275_ssr128 microsatellite FC875275_ssr128:128..139. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9419 contig Ccv1_Contig9419:157..896. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875275 vs. ExPASy Swiss-Prot
Match: YVRI_CAEEL (GILT-like protein F37H8.5 OS=Caenorhabditis elegans GN=F37H8.5 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.814e-18
Identity = 58/177 (32.77%), Postives = 92/177 (51.98%), Query Frame = 1
Query:  187 CFLSGFVSASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCI-ESLVYEHKYSH-WETCFDKLELD---PKPIVDCYTSGYGTQLELKYAAETNSLVP-PHQYVPWVVVDG 699
            C  + F    R +    N K+ + +  E+LCP   NF+   L  I    +  + V++ L P+GNAK+  + T  CQHG  EC +N  E C IDS  +     P + CI ESL  + +++   + CF+KL++     +    C  S  G  L+ K AA T ++ P  H++VPWV+++G
Sbjct:   58 CGFASFCDKHRAATH--NQKINITVLIEALCPDCQNFLTKQLYPIVFK-NFANYVNIELVPFGNAKVLEDGTIKCQHGEEECSINKFEGCFIDSMQD-QSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIING 230          
BLAST of FC875275 vs. ExPASy Swiss-Prot
Match: GILT_HUMAN (Gamma-interferon-inducible lysosomal thiol reductase OS=Homo sapiens GN=IFI30 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 8.640e-17
Identity = 56/169 (33.14%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  247 VKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAK---IRANSTFDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHKYSHWETCFDKLE--LDPKPIVDCYTSGYGTQLELKYAAETNSLVPPHQYVPWVVVDGHHCMKTTKICSYI 738
            V + LYYE+LC     F+I  L   +  + ++ I+++ L P+GNA+   +     F CQHG  EC  N VEAC +D   ++   F  I C+E   +E        C       L P  I++C     G QL    A  T++L PPH+YVPWV V+G      T++ + +
Sbjct:   73 VNVTLYYEALCGGCRAFLIRELFPTW--LLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDEL-DMELAFLTIVCMEE--FEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLV 236          
BLAST of FC875275 vs. ExPASy Swiss-Prot
Match: YKJ2_CAEEL (GILT-like protein C02D5.2 OS=Caenorhabditis elegans GN=C02D5.2 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.525e-13
Identity = 48/169 (28.40%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  211 ASRTSPSDVNSKVKLGLYYESLCPYSANFIINYLVKIFEDVDLLSIVDLHLSPWGNAKIRANST---FDCQHGPSECLLNTVEACAIDSWPELNKHFPFIYCIESLVYEHKYSHWETCFDKLELDP---KPIVDCYTSGYGTQLELKYAAETNSLVPPHQYVPWVVVDG 699
            A  T    V + VKL +Y E+ CP ++ F    L K ++ +  L+ ++L++ P+G A+           CQHGP+EC +N +  C ID +   +++ P + C++      KYS  E      E  P   + + +C +   G +L      +T SL P   ++PW+V++G
Sbjct:  127 AGPTIKEPVENIVKLDVYMEAQCPDTSRFFRQQLKKAWDILGRLNRIELNVIPFGKARCTEKGNDFECQCQHGPTECQINQLMNCVIDRFGFPHRYLPGVLCMQG-----KYSLDEAMKCVTENYPSEYERMRECASGTRGRRLLALSGQKTASLTPAIDFIPWIVING 290          
The following BLAST results are available for this feature:
BLAST of FC875275 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
YVRI_CAEEL7.814e-1832.77GILT-like protein F37H8.5 OS=Caenorhabditis elegan... [more]
GILT_HUMAN8.640e-1733.14Gamma-interferon-inducible lysosomal thiol reducta... [more]
YKJ2_CAEEL1.525e-1328.40GILT-like protein C02D5.2 OS=Caenorhabditis elegan... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31402B07EF CTVClemen1 Citrus clementina cDNA clone C31402B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875275 ID=FC875275|Name=FC875275|organism=Citrus clementina|type=EST|length=739bp
GACTGACAATTAATGTCTCCGTGTTGCTTTCATGCGCGAAAATGTCGTAA
CTAAACCATTCTCGCACTTTTTCACTTAAGAAGAACGGGGAAAAAAAAAT
ATCCCTAATTTACGGATTCATCTATGGCTTCTTCTTCTTATTCCTCAACA
AAAGCCTTATCTCTTGTCTTTTACATTACCTTGTTCTGCTTCTTGTCTGG
CTTTGTTTCAGCTTCTAGAACTTCACCTTCAGATGTCAACAGTAAAGTCA
AGTTAGGTCTGTACTACGAGTCTTTGTGTCCATACAGTGCCAATTTCATT
ATCAATTACTTGGTTAAAATCTTTGAAGATGTTGATCTGTTATCCATCGT
TGATCTCCATCTTTCTCCCTGGGGGAATGCCAAAATCAGAGCCAACAGCA
CCTTTGATTGCCAGCATGGCCCTTCTGAATGCTTGCTGAACACTGTGGAA
GCTTGTGCGATTGATAGTTGGCCTGAATTGAACAAGCATTTCCCGTTTAT
CTACTGCATTGAGAGTTTAGTGTACGAGCATAAGTATTCTCACTGGGAAA
CATGCTTTGATAAATTGGAACTGGATCCGAAGCCAATTGTTGATTGCTAT
ACCAGTGGATATGGAACACAGCTTGAGTTAAAATATGCAGCTGAGACAAA
TTCCCTTGTGCCTCCTCATCAATATGTGCCTTGGGTTGTTGTGGATGGAC
ACCACTGTATGAAGACTACGAAAATTTGTAGCTATATCT
back to top