FC875467

Overview
NameFC875467
Unique NameFC875467
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length771
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875467_ssr136 microsatellite FC875467_ssr136:136..147. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875467_ssr21 microsatellite FC875467_ssr21:21..36. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig12842 contig Ccv1_Contig12842:39..810. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL5_ARATH (Zinc finger protein CONSTANS-LIKE 5 OS=Arabidopsis thaliana GN=COL5 PE=2 SV=2)

HSP 1 Score: 214.542 bits (545), Expect = 5.020e-55
Identity = 116/211 (54.98%), Postives = 141/211 (66.82%), Query Frame = 1
Query:   58 MGIELHSVKVISGGWSVAAKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIHNCMNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFDSADSIV----KSSAFNFLVPSDQNGGSEFTGASEHDGVDSASWLIPN--SKPGIENAG--EMKSGDMFFIDPFIDLNDFDYPNSFQNH-HSAGMDSVVPVQT 663
            MG  L S+K ISGGW  AA+ CD CK+  AAVFCRVDSAFLC+ CD RIH+   +H RVW+CEVCEQAPAAVTCKADAAALCV+CD DIHSANPLA RHER+P+E FFDSA++ V     SS F  L  S     +     ++  G+    WL+PN  ++P     G   MK    F    F  L DF++PNSF +H ++AG DS+VPVQT
Sbjct:    1 MGFGLESIKSISGGWGAAARSCDACKSVTAAVFCRVDSAFLCIACDTRIHS-FTRHERVWVCEVCEQAPAAVTCKADAAALCVSCDADIHSANPLASRHERVPVETFFDSAETAVAKISASSTFGILGSSTTVDLTAVPVMADDLGL--CPWLLPNDFNEPAKIEIGTENMKGSSDFMFSDFDRLIDFEFPNSFNHHQNNAGGDSLVPVQT 208          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL4_ARATH (Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis thaliana GN=COL4 PE=2 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 1.239e-45
Identity = 105/217 (48.39%), Postives = 139/217 (64.06%), Query Frame = 1
Query:  106 VAAKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIH---NCMNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFD--SADSIVKSSAFNFLVP---SDQNGGSEFTGASEHDGVDSASW-LIPNSK------------------PGIENAGEMKSGDMFFI---DPFIDLN--DFDYPNSFQNHHSAGMDSVVPVQ 660
            +A+K CD+CK+A AA++CR D+AFLCL+CD ++H      ++HARVWMCEVCEQAPA VTCKADAAALCVTCD DIHSANPLARRHER+P+ PF+D  S+D  VK +A NFL     SD +G     G+ E +  ++ASW L+PN K                  PG  ++ EM +G  +     DP++DL+  + D        +S+G D VVPV+
Sbjct:    1 MASKLCDSCKSATAALYCRPDAAFLCLSCDSKVHAANKLASRHARVWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLARRHERVPVTPFYDSVSSDGSVKHTAVNFLDDCYFSDIDG----NGSREEEEEEAASWLLLPNPKTTTTATAGIVAVTSAEEVPG--DSPEMNTGQQYLFSDPDPYLDLDYGNVDPKVESLEQNSSGTDGVVPVE 211          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL3_ARATH (Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis thaliana GN=COL3 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.861e-39
Identity = 92/190 (48.42%), Postives = 120/190 (63.16%), Query Frame = 1
Query:  109 AAKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIHNC---MNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFDSADSIVK-SSAFNFLVPSDQNGGSEFTGASEHDGVDSASWLIPNSKPGIENAGEMKSGDMFFIDPFIDLNDFDYP--NSFQNHHSAGMDSVVPVQ 660
            +++ CD+CK+ AA +FCR D+AFLC +CD +IH      ++H RVW+CEVCEQAPA VTCKADAAALCVTCD DIHSANPL+RRHER+PI PF+D+       SS+ NF+   D++GG             +ASWL+  +K GIE        ++F        +D DYP        +S+G D VVPVQ
Sbjct:    4 SSRLCDSCKSTAATLFCRADAAFLCGDCDGKIHTANKLASRHERVWLCEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHERVPITPFYDAVGPAKSASSSVNFV---DEDGGDV-----------TASWLL--AKEGIEIT------NLF--------SDLDYPKIEVTSEENSSGNDGVVPVQ 163          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL2_ARATH (Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis thaliana GN=COL2 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 9.843e-35
Identity = 83/201 (41.29%), Postives = 121/201 (60.20%), Query Frame = 1
Query:   91 SGGWSVAAKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIH---NCMNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFDSADSIVKSSAFNFLVPSDQNGGSEFTGASEHDGVDSASWLIPNSKPGIENAGEMKSGDMFFIDPFIDLNDF--DYPNSFQNH------HSAGMDSVVPVQ 660
            SG W   A+ CDTC++AA  V+C  DSA+LC  CD R+H      ++H RV +C+ CE APAA  CKADAA+LC  CD +IHSANPLARRH+R+PI P        + +++ + + PS+ +        ++ D  + ASWL+PN  PG +N G   +G +F ++ ++DL D+     N F+++       S G D VVP+Q
Sbjct:    9 SGTW---ARACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRVPILP--------LSANSCSSMAPSETDAD------NDEDDREVASWLLPN--PG-KNIGNQNNGFLFGVE-YLDLVDYSSSMDNQFEDNQYTHYQRSFGGDGVVPLQ 188          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL1_ARATH (Zinc finger protein CONSTANS-LIKE 1 OS=Arabidopsis thaliana GN=COL1 PE=1 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 4.885e-34
Identity = 82/200 (41.00%), Postives = 113/200 (56.50%), Query Frame = 1
Query:  112 AKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIH---NCMNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFD-SADSIVKSSAFNFLVPSDQNGGSEFTGASEHDGVDSASWLIPNSKPGIENAGEMKSGDMFFIDPFIDLNDF--------DYPNSFQ-----NHHSAGMDSVVPVQ 660
            A+ CDTC++AA  V+CR DSA+LC +CD ++H      ++H RV +C+ CE+APAA  CKADAA+LC TCD++IHSANPLARRH+R+PI P  + S  S   + +    V   +N         + D  ++ASWL+PNS     N      G     D F++L D+        D  N +Q        S G D VVP+Q
Sbjct:    9 AQACDTCRSAACTVYCRADSAYLCSSCDAQVHAANRLASRHERVRVCQSCERAPAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISEYSYSSTATNHSCETTVTDPENRLVLGQEEEDEDEAEAASWLLPNSGKNSGNNNGFSIG-----DEFLNLVDYSSSDKQFTDQSNQYQLDCNVPQRSYGEDGVVPLQ 203          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: CONS_ARATH (Zinc finger protein CONSTANS OS=Arabidopsis thaliana GN=CO PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 9.212e-33
Identity = 80/217 (36.87%), Postives = 117/217 (53.92%), Query Frame = 1
Query:   88 ISGGWSVAAKPCDTCKAAAAAVFCRVDSAFLCLNCDLRIHNC---MNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPF----FDSADSIVKSSAFNFLVPS-----DQNGGSEFTGASEHDGVDSASWLIPNSKPGIENAGEMKSGDMFFIDPFIDLNDFD------YPNSFQNHH--------SAGMDSVVPVQ 660
            I  G +  A+PCDTC++ A  V+C  DSA+LC++CD ++H+     ++H RV +CE CE+APAA  C+AD A+LC  CD+++HSANPLARRH+R+PI P     F S  +    S      P      DQ  G E     + D  + ASWL PNS     N    ++  + F D +++L D++      +   +  H         S G D VVP++
Sbjct:    9 IGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEE----GDKDAKEVASWLFPNSDKNNNN----QNNGLLFSDEYLNLVDYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLK 217          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL15_ARATH (Zinc finger protein CONSTANS-LIKE 15 OS=Arabidopsis thaliana GN=COL15 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.787e-13
Identity = 35/90 (38.89%), Postives = 47/90 (52.22%), Query Frame = 1
Query:  118 PCDTCKAAAAAVFCRVDSAFLCLNCDLRIHNC---MNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPF 378
            PCD C    A +FCR D+A LCL CD ++H       KH R  +C+ C   P +V C  D   LC  CD D+H +  ++  H R  +E F
Sbjct:    8 PCDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNCGNEPVSVRCFTDNLILCQECDWDVHGSCSVSDAHVRSAVEGF 97          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL14_ARATH (Zinc finger protein CONSTANS-LIKE 14 OS=Arabidopsis thaliana GN=COL14 PE=2 SV=2)

HSP 1 Score: 75.0998 bits (183), Expect = 4.753e-13
Identity = 34/89 (38.20%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  121 CDTCKAAAAAVFCRVDSAFLCLNCDLRIHNC---MNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPF 378
            C+ C    A +FCR D+A LCL CD  +H+      KH R  +C+ C + P +V C  D   LC  CD D+H +   +  HER  +E F
Sbjct:   12 CEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQICDNCSKEPVSVRCFTDNLVLCQECDWDVHGSCSSSATHERSAVEGF 100          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: COL13_ARATH (Zinc finger protein CONSTANS-LIKE 13 OS=Arabidopsis thaliana GN=COL13 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.806e-12
Identity = 33/89 (37.08%), Postives = 52/89 (58.43%), Query Frame = 1
Query:  121 CDTCKAAAAAVFCRVDSAFLCLNCDLRIH---NCMNKHARVWMCEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPF 378
            CD C ++ A V+C+ DSA LCL CD ++H       KH R  +C+ C ++P+++ C+ + + LC  CD   H+A+  +  H R P E F
Sbjct:   13 CDYCDSSVALVYCKADSAKLCLACDKQVHVANQLFAKHFRSLLCDSCNESPSSLFCETERSVLCQNCDWQHHTAS--SSLHSRRPFEGF 99          
BLAST of FC875467 vs. ExPASy Swiss-Prot
Match: STHX_ARATH (Probable salt tolerance-like protein At1g75540 OS=Arabidopsis thaliana GN=At1g75540 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.964e-12
Identity = 41/132 (31.06%), Postives = 59/132 (44.70%), Query Frame = 1
Query:  121 CDTCKAAAAAVFCRVDSAFLCLNCDLRIHNC---MNKHARVWM------------CEVCEQAPAAVTCKADAAALCVTCDNDIHSANPLARRHERLPIEPFFDSADSIVKSSAFNFLVPSDQNGGSEFTGAS 471
            CD C    A+VFC  D A LC  CD ++H+     +KH R  +            C++C+   A + C+ D A LC  CD+ IH+AN   ++H+R  +     SA S V          S  N      G+S
Sbjct:    5 CDVCDKEEASVFCTADEASLCGGCDHQVHHANKLASKHLRFSLLYPSSSNTSSPLCDICQDKKALLFCQQDRAILCKDCDSSIHAANEHTKKHDRFLLTGVKLSATSSVYKPTSKSSSSSSSNQDFSVPGSS 136          
The following BLAST results are available for this feature:
BLAST of FC875467 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
COL5_ARATH5.020e-5554.98Zinc finger protein CONSTANS-LIKE 5 OS=Arabidopsis... [more]
COL4_ARATH1.239e-4548.39Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis... [more]
COL3_ARATH3.861e-3948.42Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis... [more]
COL2_ARATH9.843e-3541.29Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis... [more]
COL1_ARATH4.885e-3441.00Zinc finger protein CONSTANS-LIKE 1 OS=Arabidopsis... [more]
CONS_ARATH9.212e-3336.87Zinc finger protein CONSTANS OS=Arabidopsis thalia... [more]
COL15_ARATH2.787e-1338.89Zinc finger protein CONSTANS-LIKE 15 OS=Arabidopsi... [more]
COL14_ARATH4.753e-1338.20Zinc finger protein CONSTANS-LIKE 14 OS=Arabidopsi... [more]
COL13_ARATH1.806e-1237.08Zinc finger protein CONSTANS-LIKE 13 OS=Arabidopsi... [more]
STHX_ARATH8.964e-1231.06Probable salt tolerance-like protein At1g75540 OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404C06EF CTVClemen1 Citrus clementina cDNA clone C31404C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875467 ID=FC875467|Name=FC875467|organism=Citrus clementina|type=EST|length=771bp
GACTCCGGAGACCAAAACTCAAAGAAAGAAAGAAAGAGGCTTTATTTAGT
AATGCCCATGGGAATTGAATTACATAGCGTGAAGGTTATTTCCGGCGGGT
GGAGCGTGGCGGCGAAGCCATGCGACACTTGCAAAGCGGCGGCGGCGGCT
GTTTTCTGCAGAGTTGACTCTGCTTTCCTATGCCTGAACTGCGATTTAAG
AATCCACAATTGCATGAACAAACACGCGCGTGTCTGGATGTGCGAGGTCT
GCGAGCAGGCCCCTGCGGCTGTCACGTGTAAGGCTGATGCGGCTGCCTTG
TGTGTCACGTGCGACAATGATATCCACTCTGCCAACCCTTTAGCCCGGCG
CCATGAACGCCTCCCTATTGAGCCGTTCTTCGACTCGGCTGACTCGATTG
TCAAGTCGTCGGCTTTTAACTTCCTGGTTCCGAGTGATCAAAATGGCGGC
TCAGAGTTTACTGGCGCCAGTGAACACGACGGCGTGGACTCTGCTTCCTG
GCTGATTCCGAATTCGAAACCTGGAATTGAAAACGCGGGTGAAATGAAAT
CCGGGGATATGTTTTTCATCGATCCGTTTATTGATTTGAATGATTTTGAT
TATCCGAATTCATTTCAGAATCATCATAGCGCTGGCATGGACAGTGTTGT
GCCTGTTCAAACAACTAAACCGGAACCATTCCAGCTCAAGCTGCAGCTCC
AATTCCCTTTGATCACATGAAAATTTGCTCGATATCGATTTCTGTAGATC
CAGCTCTCTTCATTCACTACC
back to top