FC875468

Overview
NameFC875468
Unique NameFC875468
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14327 contig Ccv1_Contig14327:257..966. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA5_ARATH (Histone deacetylase 5 OS=Arabidopsis thaliana GN=HDA5 PE=2 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 6.888e-109
Identity = 181/236 (76.69%), Postives = 210/236 (88.98%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW KLQ AG+ +RCVVL S +A+DK+L  VHT++HVNL+K+IS+KQ D RR+RIAS+LNSIYLN GSSEAAYLAAGSV+++AE+VAEGEL+  FAIVRPPGHHAE DEAMGFCL+NNVAVAASFLLNERP+LG+ KILIVDWDVHHGN TQKMFWKDPRVLFFSVHRHE+G FYPA DDG Y M+GEGPG G+NINVPW+ GRCGDADYLA WDHIL+P  ++F PD+I +SAGFD
Sbjct:   56 IWEKLQLAGVSQRCVVLGSSKAEDKHLQLVHTKDHVNLVKSISTKQKDYRRNRIASQLNSIYLNGGSSEAAYLAAGSVVKLAEKVAEGELDCGFAIVRPPGHHAEADEAMGFCLFNNVAVAASFLLNERPDLGVKKILIVDWDVHHGNGTQKMFWKDPRVLFFSVHRHEYGGFYPAGDDGDYNMVGEGPGEGFNINVPWDQGRCGDADYLAAWDHILIPVAREFNPDVIFLSAGFD 291          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA18_ARATH (Histone deacetylase 18 OS=Arabidopsis thaliana GN=HDA18 PE=2 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 1.486e-103
Identity = 174/236 (73.73%), Postives = 206/236 (87.29%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW KLQ AG+ +RCVVL   +A+DK+L  VHT+ HVNL+K+IS+K+ DSRR++IAS+L+SIYLN GSSEAAYLAAGSV++VAE+VAEGEL+  FAIVRPPGHHAE DEAMGFCL+NNVAVAASFLLNERP+L + KILIVDWD+HHGN TQKMFWKD RVL FSVHRH+ G+FYP  DDG + M+GEGPG G+NINVPWE G CGDADYLAVW+HIL+P  K+F PDII++SAGFD
Sbjct:   89 IWEKLQLAGVTQRCVVLGGSKAEDKHLKLVHTKKHVNLVKSISTKKKDSRRNKIASQLDSIYLNGGSSEAAYLAAGSVVKVAEKVAEGELDCGFAIVRPPGHHAESDEAMGFCLFNNVAVAASFLLNERPDLDVKKILIVDWDIHHGNGTQKMFWKDSRVLIFSVHRHDHGSFYPFGDDGDFNMVGEGPGEGFNINVPWEQGGCGDADYLAVWNHILIPVTKEFKPDIILLSAGFD 324          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC6_MOUSE (Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=2)

HSP 1 Score: 201.83 bits (512), Expect = 2.941e-51
Identity = 100/235 (42.55%), Postives = 146/235 (62.13%), Query Frame = 2
Query:   14 LQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISS-KQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASF--LLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            L+  G+  RC++L ++ A    LL+ H+  +V  ++     K  D  R+   +  +SIY+   +   A LA G+   + E V  GE+ +  A+VRPPGHHAEP+ A GFC +N+VAVAA    ++  R      +ILIVDWDVHHGN TQ +F  DP VL+ S+HR++ GTF+P  D+G  + +G   G+G+ +NVPW   R GDADYLA W  ++LP   +F P++++ISAGFD
Sbjct:  513 LEEVGLAARCLILPARPALGSELLTCHSAEYVEHLRTTEKMKTRDLHRE--GANFDSIYICPSTFACAKLATGAACRLVEAVLSGEVLNGIAVVRPPGHHAEPNAACGFCFFNSVAVAARHAQIIAGRAL----RILIVDWDVHHGNGTQHIFEDDPSVLYVSLHRYDRGTFFPMGDEGASSQVGRDAGIGFTVNVPWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLISAGFD 741          

HSP 2 Score: 182.57 bits (462), Expect = 1.847e-45
Identity = 92/236 (38.98%), Postives = 143/236 (60.59%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            I  +L   G+  RCV   +  A+ + L+ VH+  +++L++          R  +A   +S+YL+  S   A LA GSV+ + + +   E+ +  A++RPPGHHA+ +   G+C++N++AVAA +   +     I ++LIVDWDVHHG  TQ +F +DP VL+FS+HR+E G F+P      ++ IG G G GY INVPW      DADY+A + HILLP   +F P +++++AGFD
Sbjct:  114 IREQLILEGLLGRCVSFQAWFAEKEELMLVHSLEYIDLMETTQYMNEGELRV-LAETYDSVYLHPNSYSCACLATGSVLRLVDALMGAEIRNGMAVIRPPGHHAQHNLMDGYCMFNHLAVAARYAQKKHR---IQRVLIVDWDVHHGQGTQFIFDQDPSVLYFSIHRYEHGRFWPHLKASNWSTIGFGQGQGYTINVPWNQTGMRDADYIAAFLHILLPVASEFQPQLVLVAAGFD 345          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDA1_YEAST (Histone deacetylase HDA1 OS=Saccharomyces cerevisiae GN=HDA1 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.941e-51
Identity = 94/217 (43.32%), Postives = 139/217 (64.06%), Query Frame = 2
Query:   59 KEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            + A  + +L VHT+ H+  I++ + K       +   K +S+Y N  S  +A L  G  IE  + V EG + ++ A+VRPPGHHAEP  A GFCL++NVAVAA  +L   PE  + +I+I+DWD+HHGN TQK F++D +VL+ S+HR E G +YP    G Y   GEG G G+N N+ W  G  GDA+Y+  ++ +++P  ++F PD++IIS+GFD
Sbjct:  124 RAATSEEILEVHTKEHLEFIES-TEKMSREELLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPE-SVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC6_HUMAN (Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2)

HSP 1 Score: 201.06 bits (510), Expect = 5.017e-51
Identity = 99/233 (42.49%), Postives = 140/233 (60.09%), Query Frame = 2
Query:   11 KLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            +L+  G+  RC+ L  + A +  LL+ H+  +V  ++  + K       R +S  +SIY+   +   A LA G+   + E V  GE+ +  A+VRPPGHHAE D A GFC +N+VAVAA             +ILIVDWDVHHGN TQ MF  DP VL+ S+HR++ GTF+P  D+G  + IG   G G+ +NV W   R GDADYLA W  ++LP   +F P+++++SAGFD
Sbjct:  513 RLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHLR-ATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHA--LRILIVDWDVHHGNGTQHMFEDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPELVLVSAGFD 742          

HSP 2 Score: 182.185 bits (461), Expect = 2.412e-45
Identity = 93/236 (39.41%), Postives = 142/236 (60.17%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            I  +L   G+  RCV   ++ A+ + L+ VH+  +++L++          R  +A   +S+YL+  S   A LA+GSV+ + + V   E+ +  AI+RPPGHHA+     G+C++N+VAVAA +   +     I ++LIVDWDVHHG  TQ  F +DP VL+FS+HR+E G F+P      ++  G G G GY INVPW      DADY+A + H+LLP   +F P +++++AGFD
Sbjct:  115 IKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRV-LADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHR---IRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFD 346          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC4_MOUSE (Histone deacetylase 4 OS=Mus musculus GN=Hdac4 PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.118e-50
Identity = 103/250 (41.20%), Postives = 157/250 (62.80%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKN--ISSKQFDSRRDRIASKL---------NSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENG---RCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW++LQ  G+  +C  +  ++A  + L +VH+E H  L     ++ ++ DS    +  +L         ++I+    SS AA LA G V+E+  +VA GEL + FA+VRPPGHHAE    MGFC +N+VAVAA  L   +  L ++KILIVDWDVHHGN TQ+ F+ DP VL+ S+HR++ G F+P +  G    +G GPG+G+N+N+ +  G     GDA+YLA +  +++P   +F PD++++S+GFD
Sbjct:  682 IWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLL---QQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYMSLHRYDDGNFFPGS--GAPDEVGTGPGVGFNVNMAFTGGLEPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFD 926          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC4_RAT (Histone deacetylase 4 OS=Rattus norvegicus GN=Hdac4 PE=1 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 1.460e-50
Identity = 102/250 (40.80%), Postives = 157/250 (62.80%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKN--ISSKQFDSRRDRIASKL---------NSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENG---RCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW++LQ  G+  +C  +  ++A  + L +VH+E H  L     ++ ++ DS    +  +L         ++I+    SS AA LA G V+E+  +VA GEL + FA+VRPPGHHAE    MGFC +N+VA+AA  L   +  L ++KILIVDWDVHHGN TQ+ F+ DP VL+ S+HR++ G F+P +  G    +G GPG+G+N+N+ +  G     GDA+YLA +  +++P   +F PD++++S+GFD
Sbjct:  683 IWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLL---QQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYMSLHRYDDGNFFPGS--GAPDEVGTGPGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFD 927          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: CLR3_SCHPO (Histone deacetylase clr3 OS=Schizosaccharomyces pombe GN=clr3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.252e-50
Identity = 94/218 (43.12%), Postives = 135/218 (61.93%), Query Frame = 2
Query:   56 SKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENGRCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            ++EA  + LL VH++   + + N      +   + +    +S+Y N  S+  A LA GS IE    V  G++ +AFA+VRPPGHHAEP +  GFCL+NNV+V A  +L   P+  I ++LIVDWD+HHGN TQ  F+ DP VL+ S+HR+E G FYP  + G     GEGPGLG  +N+PW     GD DY+  +  +++P   +F PD++I+S GFD
Sbjct:  112 AREATLEELLQVHSQEMYDRVTNTEKMSHEDLAN-LEKISDSLYYNNESAFCARLACGSAIETCTAVVTGQVKNAFAVVRPPGHHAEPHKPGGFCLFNNVSVTARSMLQRFPDK-IKRVLIVDWDIHHGNGTQMAFYDDPNVLYVSLHRYENGRFYPGTNYGCAENCGEGPGLGRTVNIPWSCAGMGDGDYIYAFQRVVMPVAYEFDPDLVIVSCGFD 327          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC5_MOUSE (Histone deacetylase 5 OS=Mus musculus GN=Hdac5 PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 4.247e-50
Identity = 99/256 (38.67%), Postives = 158/256 (61.72%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKN--ISSKQFDSRR--DRIASKL-------------NSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENG---RCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW++LQ  G+  +C  +  ++A    + +VH+E H  L     ++ ++ DS++    I+ K+             ++++    SS A  +A G ++E+A +VA GEL + FAI+RPPGHHAE   AMGFC +N+VA+ A  L   + +L + K+LIVDWD+HHGN TQ+ F+ DP VL+ S+HR++ G F+P +  G    +G GPG+GYN+NV W  G     GD +YL  +  +++P  ++F PD++++SAGFD
Sbjct:  705 IWSRLQETGLLGKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLL---QQKLSVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNFFPGS--GAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAQEFSPDVVLVSAGFD 955          
BLAST of FC875468 vs. ExPASy Swiss-Prot
Match: HDAC5_CRIGR (Histone deacetylase 5 OS=Cricetulus griseus GN=HDAC5 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 5.547e-50
Identity = 99/256 (38.67%), Postives = 157/256 (61.33%), Query Frame = 2
Query:    2 IWNKLQAAGIPRRCVVLNSKEAKDKNLLSVHTENHVNLIKN--ISSKQFDSRR--DRIASKL-------------NSIYLNEGSSEAAYLAAGSVIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKILIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINVPWENG---RCGDADYLAVWDHILLPGCKDFGPDIIIISAGFD 709
            IW++LQ  G+  +C  +  ++A    + +VH+E H  L     ++ ++ DS++    I+ K+             ++++    SS A  +A G ++E+A +VA GEL + FAI+RPPGHHAE   AMGFC +N+VA+ A  L   + +L + K+LIVDWD+HHGN TQ+ F+ DP VL+ S+HR++ G F+P +  G    +G GPG+GYN+NV W  G     GD +YL  +  +++P   +F PD++++SAGFD
Sbjct:  703 IWSRLQETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAMLPCGGIGVDSDTVWNEMHSSSAVRMAVGCLVELAFKVAAGELKNGFAIIRPPGHHAEESTAMGFCFFNSVAITAKLL---QQKLNVGKVLIVDWDIHHGNGTQQAFYDDPSVLYISLHRYDNGNFFPGS--GAPEEVGGGPGMGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVSAGFD 953          
The following BLAST results are available for this feature:
BLAST of FC875468 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
HDA5_ARATH6.888e-10976.69Histone deacetylase 5 OS=Arabidopsis thaliana GN=H... [more]
HDA18_ARATH1.486e-10373.73Histone deacetylase 18 OS=Arabidopsis thaliana GN=... [more]
HDAC6_MOUSE2.941e-5142.55Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=... [more]
HDA1_YEAST2.941e-5143.32Histone deacetylase HDA1 OS=Saccharomyces cerevisi... [more]
HDAC6_HUMAN5.017e-5142.49Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=... [more]
HDAC4_MOUSE1.118e-5041.20Histone deacetylase 4 OS=Mus musculus GN=Hdac4 PE=... [more]
HDAC4_RAT1.460e-5040.80Histone deacetylase 4 OS=Rattus norvegicus GN=Hdac... [more]
CLR3_SCHPO3.252e-5043.12Histone deacetylase clr3 OS=Schizosaccharomyces po... [more]
HDAC5_MOUSE4.247e-5038.67Histone deacetylase 5 OS=Mus musculus GN=Hdac5 PE=... [more]
HDAC5_CRIGR5.547e-5038.67Histone deacetylase 5 OS=Cricetulus griseus GN=HDA... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404C07EF CTVClemen1 Citrus clementina cDNA clone C31404C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875468 ID=FC875468|Name=FC875468|organism=Citrus clementina|type=EST|length=710bp
GATTTGGAACAAGCTCCAAGCCGCTGGCATTCCTCGACGGTGTGTCGTTT
TAAATTCCAAAGAAGCGAAAGACAAAAATCTACTGTCTGTGCACACGGAA
AATCATGTTAATTTGATTAAGAATATAAGCTCAAAGCAGTTTGATTCCCG
AAGAGATAGGATTGCGTCAAAATTAAATTCAATTTACTTAAATGAAGGAT
CATCGGAGGCTGCTTATCTTGCTGCCGGTTCAGTTATAGAGGTCGCCGAG
AGAGTTGCCGAAGGGGAGTTGAATTCTGCTTTTGCTATTGTGAGACCTCC
TGGTCATCATGCTGAACCAGATGAAGCTATGGGATTTTGTCTATACAACA
ATGTGGCTGTTGCTGCAAGTTTCCTATTAAATGAAAGACCAGAACTGGGA
ATCAATAAAATTTTGATTGTTGATTGGGATGTTCACCATGGTAACAGTAC
TCAAAAGATGTTCTGGAAGGATCCCCGTGTCCTATTCTTCTCTGTTCATA
GGCATGAGTTTGGAACTTTTTATCCTGCCAATGATGATGGTTTCTATACT
ATGATTGGTGAAGGACCTGGTTTGGGATACAACATTAATGTCCCTTGGGA
GAATGGGAGGTGCGGTGATGCAGACTATCTGGCAGTTTGGGACCATATTT
TACTTCCTGGTTGCAAGGATTTTGGACCTGACATAATCATAATATCTGCT
GGATTCGATG
back to top