FC875477

Overview
NameFC875477
Unique NameFC875477
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length712
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9348 contig Ccv1_Contig9348:1..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875477 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.197e-28
Identity = 65/121 (53.72%), Postives = 79/121 (65.29%), Query Frame = 2
Query:   56 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMXXXXXXXXXXXXXXXXXXXRKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 418
            +L+KLWDD+VAGPQP+RGLG LRK+   PL +K+ GE+           S                    RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW+YSGETRSKHH
Sbjct:    3 LLDKLWDDIVAGPQPERGLGMLRKVPQ-PLNLKDEGES-----------SKITMPTTPTTPVTPTTPISARKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDWMYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of FC875477 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN1.197e-2853.72Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31404D04EF CTVClemen1 Citrus clementina cDNA clone C31404D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875477 ID=FC875477|Name=FC875477|organism=Citrus clementina|type=EST|length=712bp
GACTGAAGAAGAGGTTAAAGATTTAGAAACTAGCAGCTAAATTGTAAATT
TAAAGATGCTAGAGAAGCTTTGGGACGATGTTGTGGCAGGGCCTCAGCCT
GATCGTGGCCTTGGCAGGCTGAGGAAAATCACCACAACACCCTTAGCAGT
CAAAGAGGGTGGTGAGGCGGAGTCGTCGTCGGGCAAGTTCCAGAGGTCTC
TGTCAATGCCAGCGAGTCCAGGGGCACCGTCGACGCCAGTGACGCCGACG
ACGCCGCTGTCGGCGCGTAAGGACAACGTGTGGAGGAGCGTGTTTCACCC
CGGTAGCAACCTTGCTACTAGGGGTATCGGTGCAGAGGTCTTTGACAAGC
CCACACATCCTAACTCTCCCACTGTTTATGACTGGCTTTACAGTGGGGAG
ACTAGGAGCAAGCATCATCACTGAGTGGATGATACGCTCCAGCGATGTAA
ATGAATGTGATGGGTCACCAACTCACCGGATGAGTTGCCTGTAGTCTGTA
GATAGTGTCGTTTCGTTTTGGATTTCGCAACGTGTCCTTGTCGTTTTGTT
AATGCTATTTGTATTACGTGTCCTTCCTATCTAAAGTTTGGTTTTAAAAT
GCTGCTGACTAANAGTAAACTAAAGACTGTGATGTTTTTATATCATATAA
TTTAATAATTGTATGTGATGTGAGGATTGCTAAGCTGTGGGCGGAGATGA
AAGGTGCTGGTT
back to top