FC875480

Overview
NameFC875480
Unique NameFC875480
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length683
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR9_ARATH (Two-component response regulator ARR9 OS=Arabidopsis thaliana GN=ARR9 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.837e-31
Identity = 69/113 (61.06%), Postives = 87/113 (76.99%), Query Frame = 2
Query:  347 FHVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            FHVLAVDDSL DRK++E LL+ SS QVT VDSG KALE+LGL  + ++N   + S      +   VNLI+TDYCMPGMTGYDLLK++K SS ++D+PVV+MSSENVP R++ C
Sbjct:    9 FHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPNAFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRC 121          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR8_ARATH (Two-component response regulator ARR8 OS=Arabidopsis thaliana GN=ARR8 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.464e-30
Identity = 68/113 (60.18%), Postives = 88/113 (77.88%), Query Frame = 2
Query:  347 FHVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVS-SWKDVPVVVMSSENVPFRVTMC 682
            FHVLAVDDSL DRK++E LL+ SS QVT VDSG KALE+LGL   +++N   + ST     +E  +NLI+TDYCMPGMTGYDLLK++K S +++ +PVV+MSSENVP R++ C
Sbjct:    9 FHVLAVDDSLFDRKMIERLLQKSSCQVTTVDSGSKALEFLGL--RVDDNDPNALSTSPQIHQEVEINLIITDYCMPGMTGYDLLKKVKESAAFRSIPVVIMSSENVPARISRC 119          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR5_ARATH (Two-component response regulator ARR5 OS=Arabidopsis thaliana GN=ARR5 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 1.779e-26
Identity = 65/112 (58.04%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDS++DRK +E LLRVSS +VT VDS  +AL+YLGL  + ENNS       S   E+ ++NLIMTDY MPGMTGY+LLK++K SS ++++PVV+MSSEN+  R+  C
Sbjct:   26 HVLAVDDSMVDRKFIERLLRVSSCKVTVVDSATRALQYLGL--DGENNS-------SVGFEDLKINLIMTDYSMPGMTGYELLKKIKESSAFREIPVVIMSSENILPRIDRC 128          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR3_ARATH (Two-component response regulator ARR3 OS=Arabidopsis thaliana GN=ARR3 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.761e-26
Identity = 62/112 (55.36%), Postives = 84/112 (75.00%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVS-SWKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDSL+DR ++E LLR++S +VT VDSG +ALE+LGL D+            + + +  +V+LI+TDYCMPGMTGY+LLK++K S S+K+VPVV+MSSENV  R+  C
Sbjct:   34 HVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDDD----------KAAVEFDRLKVDLIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRC 135          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR17_ARATH (Two-component response regulator ARR17 OS=Arabidopsis thaliana GN=ARR17 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.831e-26
Identity = 60/112 (53.57%), Postives = 82/112 (73.21%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDD+LIDRK++E +L++SS +VT  ++G +ALEYLGL D         P    +     +VNLI+TDYCMPGMTG++LLK++K SS  K+VPVV++SSEN+P R+  C
Sbjct:   21 HVLAVDDNLIDRKLVERILKISSCKVTTAENGLRALEYLGLGD---------PQQTDSLTNVMKVNLIITDYCMPGMTGFELLKKVKESSNLKEVPVVILSSENIPTRINKC 123          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR4_ARATH (Two-component response regulator ARR4 OS=Arabidopsis thaliana GN=ARR4 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.506e-25
Identity = 63/112 (56.25%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDSL+DR ++E LLR++S +VT VDSG +ALE+LGL     +N  A     S + +  +V+LI+TDYCMPGMTGY+LLK++K SS +++VPVV+MSSENV  R+  C
Sbjct:   35 HVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGL-----DNEKA-----SAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRC 136          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR7_ARATH (Two-component response regulator ARR7 OS=Arabidopsis thaliana GN=ARR7 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.476e-25
Identity = 61/112 (54.46%), Postives = 85/112 (75.89%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDS++DRK++E LLR+SS +VT V+SG +AL+YLGL D  +  SN          ++ +VNLI+TDY MPG++GYDLLK++K SS +++VPVV+MSSEN+  R+  C
Sbjct:   25 HVLAVDDSIVDRKVIERLLRISSCKVTTVESGTRALQYLGL-DGGKGASNL---------KDLKVNLIVTDYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQEC 126          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR6_ARATH (Two-component response regulator ARR6 OS=Arabidopsis thaliana GN=ARR6 PE=1 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 9.763e-25
Identity = 64/112 (57.14%), Postives = 82/112 (73.21%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDS +DRK +E LLRVSS +VT VDS  +AL+YLGL  ++E          S   E+ +VNLIMTDY MPGMTGY+LLK++K SS +++VPVV+MSSEN+  R+  C
Sbjct:   26 HVLAVDDSHVDRKFIERLLRVSSCKVTVVDSATRALQYLGL--DVEEK--------SVGFEDLKVNLIMTDYSMPGMTGYELLKKIKESSAFREVPVVIMSSENILPRIDRC 127          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR16_ARATH (Two-component response regulator ARR16 OS=Arabidopsis thaliana GN=ARR16 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.841e-24
Identity = 60/112 (53.57%), Postives = 82/112 (73.21%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDD+LIDRK++E LL++S  +VT  ++  +ALEYLGL D    N +    T +  K    V+LI+TDYCMPGMTG++LLK++K SS  ++VPVV+MSSEN+P R+  C
Sbjct:   30 HVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGLGD---QNQHIDALTCNVMK----VSLIITDYCMPGMTGFELLKKVKESSNLREVPVVIMSSENIPTRINKC 134          
BLAST of FC875480 vs. ExPASy Swiss-Prot
Match: ARR15_ARATH (Two-component response regulator ARR15 OS=Arabidopsis thaliana GN=ARR15 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 8.265e-24
Identity = 57/112 (50.89%), Postives = 82/112 (73.21%), Query Frame = 2
Query:  350 HVLAVDDSLIDRKILENLLRVSSYQVTCVDSGDKALEYLGLIDNLENNSNASPSTLSTKKEESRVNLIMTDYCMPGMTGYDLLKRLKVSS-WKDVPVVVMSSENVPFRVTMC 682
            HVLAVDDS +DRK++E LL++S+ +VT V+SG +AL+YLGL     +  N S        ++ +VNLI+TDY MPG+TGY+LLK++K SS  +++PVV+MSSEN+  R+  C
Sbjct:   19 HVLAVDDSFVDRKVIERLLKISACKVTTVESGTRALQYLGL-----DGDNGSSGL-----KDLKVNLIVTDYSMPGLTGYELLKKIKESSALREIPVVIMSSENIQPRIEQC 120          
The following BLAST results are available for this feature:
BLAST of FC875480 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
ARR9_ARATH1.837e-3161.06Two-component response regulator ARR9 OS=Arabidops... [more]
ARR8_ARATH3.464e-3060.18Two-component response regulator ARR8 OS=Arabidops... [more]
ARR5_ARATH1.779e-2658.04Two-component response regulator ARR5 OS=Arabidops... [more]
ARR3_ARATH6.761e-2655.36Two-component response regulator ARR3 OS=Arabidops... [more]
ARR17_ARATH8.831e-2653.57Two-component response regulator ARR17 OS=Arabidop... [more]
ARR4_ARATH1.506e-2556.25Two-component response regulator ARR4 OS=Arabidops... [more]
ARR7_ARATH7.476e-2554.46Two-component response regulator ARR7 OS=Arabidops... [more]
ARR6_ARATH9.763e-2557.14Two-component response regulator ARR6 OS=Arabidops... [more]
ARR16_ARATH2.841e-2453.57Two-component response regulator ARR16 OS=Arabidop... [more]
ARR15_ARATH8.265e-2450.89Two-component response regulator ARR15 OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31404D07EF CTVClemen1 Citrus clementina cDNA clone C31404D07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875480 ID=FC875480|Name=FC875480|organism=Citrus clementina|type=EST|length=683bp
ACCACTCTCTTCATATCCCACTAAGCACGCCTCTTTCTTTTCTCTTTGAT
ATATTTTCTCTTTTCAATGTAAATATATTTGTATATTTTTTTTAAAGAAA
GGGTTATAGAGTGTGTGCAAGAAATTTATATAAGCCTAGCTGAAGATCAG
TTGGTGAGAAACAGAAGAGCGATACATATATTGAATTTGCTGCTTAATTG
AAATGGAGTTGAAATCAGAAGTTGAATGCATCCCACAGCAAGAGAAACAA
CAGCTACTTGAAAACATCCCACAACAAGAACGAGAAGGGCAACTTGAAGA
CATCCCACAACAAGAAAAGCAACCGCAACAACAGCAACAAGAAACTTTTC
ATGTCTTGGCCGTTGATGATAGTCTCATTGACAGGAAGATTTTGGAGAAT
CTACTTAGAGTCTCTTCTTACCAAGTGACTTGTGTCGATTCCGGCGATAA
AGCTTTGGAATATTTGGGTCTAATTGATAACCTTGAAAACAATTCTAATG
CTTCTCCTTCAACCCTTTCAACAAAGAAAGAGGAATCGAGAGTCAACTTG
ATCATGACTGACTACTGCATGCCTGGGATGACCGGCTATGATTTGCTTAA
ACGACTCAAGGTATCCTCCTGGAAAGACGTACCGGTCGTGGTCATGTCTT
CCGAAAATGTACCCTTCAGAGTCACCATGTGCT
back to top