FC875583

Overview
NameFC875583
Unique NameFC875583
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length783
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: AVPX_ARATH (Pyrophosphate-energized membrane proton pump 3 OS=Arabidopsis thaliana GN=AVPL2 PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 6.179e-101
Identity = 193/250 (77.20%), Postives = 200/250 (80.00%), Query Frame = 2
Query:    2 YLCKWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEACS*N-ISA*YLG 748
            YL KWVL+KDEGPPEM QISDAIRDGAEGF RTQYGTISKMA LLA VI CIYLFRN TPQQEASG+GR+ SA ITVAAFLLGALCSGIAGYVGMW                  EALQIAVRAGGFS              LY+TFYVWL VD+PGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTK ADVGADLVGKVE GIPEDDPRNPAVIADLVGDNVGDCAARGADLFE+ +   ISA  LG
Sbjct:   84 YLTKWVLAKDEGPPEMVQISDAIRDGAEGFLRTQYGTISKMAFLLAFVILCIYLFRNLTPQQEASGLGRTMSAYITVAAFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGIAILYSTFYVWLDVDSPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEHGIPEDDPRNPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILG 333          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: AVP2_ARATH (Pyrophosphate-energized membrane proton pump 2 OS=Arabidopsis thaliana GN=AVPL1 PE=1 SV=2)

HSP 1 Score: 363.229 bits (931), Expect = 8.923e-100
Identity = 190/250 (76.00%), Postives = 200/250 (80.00%), Query Frame = 2
Query:    2 YLCKWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEACS*N-ISA*YLG 748
            YL KWVL+KDEGPPEM +ISDAIRDGAEGFFRTQY TISKMA LLA VI CIYLFR+ TPQQEA+G+GR+ SA ITVAAFLLGALCSGIAGYVGMW                  EALQIAVRAGGFS              LY+TFYVWLGV +PGSM VTDLPLLLVGYGFGASFVALFAQLGGGIYTK ADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE+ +   ISA  LG
Sbjct:   84 YLTKWVLAKDEGPPEMVEISDAIRDGAEGFFRTQYSTISKMAILLAFVILCIYLFRSLTPQQEAAGLGRAMSAYITVAAFLLGALCSGIAGYVGMWVSVRANVRVSSAARRSAREALQIAVRAGGFSALVVVGMAVIGIAILYSTFYVWLGVGSPGSMNVTDLPLLLVGYGFGASFVALFAQLGGGIYTKGADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFESIAAEIISAMILG 333          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_THETN (Pyrophosphate-energized proton pump OS=Thermoanaerobacter tengcongensis GN=hppA PE=3 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.438e-51
Identity = 117/250 (46.80%), Postives = 153/250 (61.20%), Query Frame = 2
Query:    5 LCKWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVA-AFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEA-CS*NISA*YLG 748
            L K++ ++D+G  +M QISDAI++GA  F   QY TI+ +A ++A++I     + + +      G  ++ S  + V  AF+ GA CS ++GY+GM+                   ALQIA++ G  +              L+  +    G D      + + P L+VG+GFGASFVALFAQLGGGIYTKAADVGADLVGKVE GIPEDDPRNPAVIADLVGDNVGDCA RGADLFE+  + NI A  LG
Sbjct:   22 LIKFIFAQDKGNEKMQQISDAIKEGAMAFLNRQYKTIASLALIVAVIIVVANYYGHLS-----EGSSQALSFALHVGFAFITGAFCSALSGYIGMYMAVNSNIRAAAGARSGLNRALQIALKGGAVTGLAVTALSLFGVATLFLAYGGLSGQDE----LIKEAPSLIVGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILG 262          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA2_METMA (Pyrophosphate-energized proton pump 2 OS=Methanosarcina mazei GN=hppA2 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.957e-38
Identity = 94/237 (39.66%), Postives = 127/237 (53.59%), Query Frame = 2
Query:    2 YLCKWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            +  K +L +D G   M +I++AI++G+  + + QY TI+ ++ +++L+I  +                  +      A FL GA+ S  AGY+GM                   +AL+IA R G  +              LY  +         G         L+VG+GFGAS ++LFA+ GGGI+TKAADVGADLVGK+E GIPEDDPRNPAVIAD VGDNVGDCA  GADLFE
Sbjct:   21 FFAKSILKEDAGNKRMKEIAEAIKEGSTAYMKRQYRTIAVVSVIISLLILFLL-----------------DEGLKIAAGFLAGAISSAAAGYIGMSISVRANVRTASAASGGAGKALKIAFRGGAVTGLAVIGLALLGTSSLYILY---------GDAD------LVVGFGFGASLISLFARAGGGIFTKAADVGADLVGKIEAGIPEDDPRNPAVIADNVGDNVGDCAGMGADLFE 225          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_OCHA4 (Pyrophosphate-energized proton pump OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=hppA PE=3 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.556e-38
Identity = 97/232 (41.81%), Postives = 125/232 (53.88%), Query Frame = 2
Query:   17 VLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            VL+ D+G   M +I++AIR+GA  +   QY TI+ +  ++ L  +  YL               S SA I    FL+GA+ SG+ G++GM                     L++A ++G  +               Y    VWLG  +P    V D    LV  GFGAS +++FA+LGGGI+TK ADVG DLVGKVE GIPEDDPRNPA IAD VGDNVGDCA   ADLFE
Sbjct:   29 VLAADQGTQRMQEIAEAIREGASAYLTRQYSTIAIVGVVVFLAAW--YLL--------------SISAAI---GFLIGAVLSGVTGFIGMHVSVRANVRTAQAASLSLAGGLELAFKSGAITGLLVAGLALLGVSVYYFILTVWLGY-SPSDRTVIDA---LVSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFE 237          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_RHORT (Pyrophosphate-energized proton pump OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=hppA PE=1 SV=3)

HSP 1 Score: 157.918 bits (398), Expect = 5.694e-38
Identity = 95/235 (40.43%), Postives = 128/235 (54.47%), Query Frame = 2
Query:   11 KWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWL-GVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            K +++ D G   M +IS A+++GA  F   QY TI+ +  ++ +++  +           + G G           FL+GA+CSGIAGYVGM+                    L++A ++G  +                A +Y+ L G+   G   +  L    V  GFGAS +++FA+LGGGI+TK ADVGADLVGKVE GIPEDDPRNPAVIAD VGDNVGDCA   ADLFE
Sbjct:   24 KTIMAADAGTARMQEISGAVQEGASAFLNRQYKTIAVVGAVVFVILTALLGI--------SVGFG-----------FLIGAVCSGIAGYVGMYISVRANVRVAAGAQQGLARGLELAFQSGAVTGMLVAGLALLSV----AFYYILLVGIGATGRALIDPL----VALGFGASLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDCAGMAADLFE 231          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_BRUSU (Pyrophosphate-energized proton pump OS=Brucella suis GN=hppA PE=3 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 5.694e-38
Identity = 94/232 (40.52%), Postives = 125/232 (53.88%), Query Frame = 2
Query:   17 VLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            VL+ D+G   M +I++AIR+GA  +   QY TI+    ++ +V+F +  +  +            N+A      FL+GA+ SG+ G++GM                     L++A ++G  +               Y    VWLG   P    V D    LV  GFGAS +++FA+LGGGI+TK ADVG DLVGKVE GIPEDDPRNPA IAD VGDNVGDCA   ADLFE
Sbjct:   29 VLAADQGTQRMQEIAEAIREGASAYLTRQYSTIA----IVGIVVFLLAWYLLSL-----------NAAM----GFLIGAVLSGVTGFIGMHVSVRANVRTAQAASLSLAGGLELAFKSGAITGLLVAGLALLGVSVYYFVLTVWLGY-APADRTVIDS---LVSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFE 237          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_BRUME (Pyrophosphate-energized proton pump OS=Brucella melitensis GN=hppA PE=3 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 5.694e-38
Identity = 94/232 (40.52%), Postives = 125/232 (53.88%), Query Frame = 2
Query:   17 VLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFE 712
            VL+ D+G   M +I++AIR+GA  +   QY TI+    ++ +V+F +  +  +            N+A      FL+GA+ SG+ G++GM                     L++A ++G  +               Y    VWLG   P    V D    LV  GFGAS +++FA+LGGGI+TK ADVG DLVGKVE GIPEDDPRNPA IAD VGDNVGDCA   ADLFE
Sbjct:   29 VLAADQGTQRMQEIAEAIREGASAYLTRQYSTIA----IVGIVVFLLAWYLLSL-----------NAAM----GFLIGAVLSGVTGFIGMHVSVRANVRTAQAASLSLAGGLELAFKSGAITGLLVAGLALLGVSVYYFVLTVWLGY-APADRTVIDS---LVSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFE 237          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_CHLAA (Pyrophosphate-energized proton pump OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=hppA PE=3 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 7.436e-38
Identity = 97/239 (40.59%), Postives = 131/239 (54.81%), Query Frame = 2
Query:   17 VLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFC-IYLFRNTTPQQEASGIGRSNSACITVA-----AFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEA 715
            +L++D G P+M ++   I+ GA  +   Q+ TIS +  +L  V+   +++   TT   E    G   +A I VA     AFL+G+L S   G+VGM                    ALQ+A ++G  +              ++  F    G+  P +         L+G+GFG S +ALF ++GGGIYTKAADVGADLVGKVE GIPEDDPRN AVIADLVGDNVGDCA   AD+FE+
Sbjct:   33 ILAQDTGTPKMREVWGFIKTGANAYLSQQFRTISILIVILTFVLAASVFIIPPTTEAVER--FGSKEAATIWVAIGRAVAFLMGSLFSYAVGFVGMNVAVEGNVRVAAAARKGYNPALQVAYKSGSVTGMLTVGLGLLGGTLIFMVF----GIAAPDA---------LLGFGFGGSLIALFMRVGGGIYTKAADVGADLVGKVEAGIPEDDPRNAAVIADLVGDNVGDCAGMAADVFES 256          
BLAST of FC875583 vs. ExPASy Swiss-Prot
Match: HPPA_AGRT5 (Pyrophosphate-energized proton pump OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=hppA PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.820e-37
Identity = 97/242 (40.08%), Postives = 127/242 (52.48%), Query Frame = 2
Query:   11 KWVLSKDEGPPEMAQISDAIRDGAEGFFRTQYGTISKMACLLALVIFCIYLFRNTTPQQEASGIGRSNSACITVAAFLLGALCSGIAGYVGMWXXXXXXXXXXXXXXXXXXEALQIAVRAGGFSXXXXXXXXXXXXXXLYATFYVWLGVDTPGSMKVTDLPLLLVGYGFGASFVALFAQLGGGIYTKAADVGADLVGKVEQGIPEDDPRNPAVIADLVGDNVGDCAARGADLFEACS*NISA 736
            K VL  D+G   M +I+  IR+GA+ +   QY TI+ +  ++A++ +  YL                  + I    F++GA+ SG+AG+VGM                     L IA ++G  +               Y      LG   PGS  V D    LV  GFGAS +++FA+LGGGI+TK ADVG DLVGKVE GIPEDDPRNPA IAD VGDNVGDCA   ADLFE  + ++ A
Sbjct:   25 KSVLDADQGNERMREIAGYIREGAQAYLTRQYLTIAIVGLIVAVLAW--YLL-----------------SAIAAIGFVIGAVLSGVAGFVGMHVSVRANLRTAQAASHSLGAGLDIAFKSGAITGMLVAGLALLGVSIYYFVLTSVLG-HPPGSRAVIDA---LVSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGDCAGMAADLFETYAVSVVA 243          
The following BLAST results are available for this feature:
BLAST of FC875583 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
AVPX_ARATH6.179e-10177.20Pyrophosphate-energized membrane proton pump 3 OS=... [more]
AVP2_ARATH8.923e-10076.00Pyrophosphate-energized membrane proton pump 2 OS=... [more]
HPPA_THETN3.438e-5146.80Pyrophosphate-energized proton pump OS=Thermoanaer... [more]
HPPA2_METMA1.957e-3839.66Pyrophosphate-energized proton pump 2 OS=Methanosa... [more]
HPPA_OCHA42.556e-3841.81Pyrophosphate-energized proton pump OS=Ochrobactru... [more]
HPPA_RHORT5.694e-3840.43Pyrophosphate-energized proton pump OS=Rhodospiril... [more]
HPPA_BRUSU5.694e-3840.52Pyrophosphate-energized proton pump OS=Brucella su... [more]
HPPA_BRUME5.694e-3840.52Pyrophosphate-energized proton pump OS=Brucella me... [more]
HPPA_CHLAA7.436e-3840.59Pyrophosphate-energized proton pump OS=Chloroflexu... [more]
HPPA_AGRT54.820e-3740.08Pyrophosphate-energized proton pump OS=Agrobacteri... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405E08EF CTVClemen1 Citrus clementina cDNA clone C31405E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875583 ID=FC875583|Name=FC875583|organism=Citrus clementina|type=EST|length=783bp
ATATCTTTGTAAGTGGGTACTCTCAAAGGATGAGGGACCTCCAGAGATGG
CTCAGATATCAGATGCAATACGAGATGGAGCTGAAGGCTTCTTCAGGACC
CAGTATGGGACTATCTCTAAGATGGCATGTTTGCTTGCTTTGGTGATTTT
TTGCATTTACCTGTTTCGCAATACAACCCCTCAACAAGAAGCTTCTGGCA
TTGGGAGGTCAAATTCTGCCTGTATTACTGTTGCTGCATTCCTTTTGGGG
GCTTTATGTTCAGGAATTGCAGGATATGTAGGGATGTGGGTGTCTGTACG
TGCAAATGTTCGAGTGTCCAGTGCTGCAAGACGGTCTGCAAGAGAGGCAT
TGCAGATAGCTGTTCGTGCTGGTGGTTTCTCTGCTATTGTGGTTGTTGGT
ATGGCTGTAATTGGCATAGCCATCCTTTATGCCACATTTTATGTTTGGCT
TGGAGTGGATACACCAGGTTCAATGAAGGTTACTGATTTGCCTCTTCTTC
TTGTGGGGTATGGTTTTGGGGCTTCATTTGTTGCACTGTTTGCCCAGTTG
GGTGGTGGAATATACACAAAAGCTGCTGATGTTGGGGCAGATCTTGTTGG
GAAAGTGGAGCAGGGAATACCTGAAGATGATCCTCGGAATCCTGCTGTCA
TTGCAGATTTGGTTGGAGACAATGTGGGTGATTGTGCTGCACGGGGTGCT
GATCTTTTTGAAGCATGCAGCTGAAATATCAGTGCTTGATACTTGGGGAA
ACATGGGTCACGTGTAACTTGAAATCATCTGGC
back to top