FC875590

Overview
NameFC875590
Unique NameFC875590
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10271 contig Ccv1_Contig10271:1..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP7_ARATH (Ubiquitin carboxyl-terminal hydrolase 7 OS=Arabidopsis thaliana GN=UBP7 PE=1 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 5.351e-87
Identity = 156/197 (79.19%), Postives = 175/197 (88.83%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQLHNGTFMQXD 687
            MLTVSVKWQK+VF ++EIDTSQ P+VFK QLYDL+GVPPERQKIMVKGGLLKDD+DWS LG+K GQ+LMMMGTADEIVKAPEKGPVF+EDLPEE+Q  +LG+SAGL NLGNTCYMNST+QCL SVPELKS L  Y QS R+ DVDQ+SHMLTVAT ELF++LDKSVK VAPM FWM+L+KKYPQF QLHNG  MQ D
Sbjct:    1 MLTVSVKWQKKVFESIEIDTSQPPFVFKAQLYDLSGVPPERQKIMVKGGLLKDDADWSTLGLKNGQKLMMMGTADEIVKAPEKGPVFMEDLPEEQQAANLGYSAGLVNLGNTCYMNSTMQCLISVPELKSELSNY-QSARTKDVDQTSHMLTVATRELFSELDKSVKAVAPMPFWMVLQKKYPQFAQLHNGNHMQQD 196          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP6_ARATH (Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabidopsis thaliana GN=UBP6 PE=1 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 3.039e-82
Identity = 149/197 (75.63%), Postives = 163/197 (82.74%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQLHNGTFMQXD 687
            M TVSVKWQK+V   +EID S  PYVFK QLYDLTGVPPERQKIMVKGGLLKDD DW+ +GVK GQ+LMMMGTADEIVKAPEK  VF EDLPEE    +LG+SAGL NLGNTCYMNST+QCL SVPELKSAL  YS + RSNDVDQ+SHMLTVAT ELF +LD+SV  V+P QFWM+LRKKYPQF QL NG  MQ D
Sbjct:    1 MPTVSVKWQKKVLDGIEIDVSLPPYVFKAQLYDLTGVPPERQKIMVKGGLLKDDGDWAAIGVKDGQKLMMMGTADEIVKAPEKAIVFAEDLPEEALATNLGYSAGLVNLGNTCYMNSTVQCLKSVPELKSALSNYSLAARSNDVDQTSHMLTVATRELFGELDRSVNAVSPSQFWMVLRKKYPQFSQLQNGMHMQQD 197          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_PANTR (Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan troglodytes GN=USP14 PE=3 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 6.618e-45
Identity = 90/198 (45.45%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL-HNGTFMQXD 687
            + +V+VKW KE F  VE++T + P VFK QL+ LTGV P RQK+MVKGG LKDD DW  + +K G  L+MMG+AD + + P    VFVED+ EE+   ++    GL NLGNTCYMN+T+QC+ SVPELK AL +Y+ + R++    S+  +T A  +LF+ +DK+   + P+     L   +PQF +    G ++Q D
Sbjct:    3 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD-DWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD 199          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_HUMAN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens GN=USP14 PE=1 SV=3)

HSP 1 Score: 180.644 bits (457), Expect = 6.618e-45
Identity = 90/198 (45.45%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL-HNGTFMQXD 687
            + +V+VKW KE F  VE++T + P VFK QL+ LTGV P RQK+MVKGG LKDD DW  + +K G  L+MMG+AD + + P    VFVED+ EE+   ++    GL NLGNTCYMN+T+QC+ SVPELK AL +Y+ + R++    S+  +T A  +LF+ +DK+   + P+     L   +PQF +    G ++Q D
Sbjct:    3 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD-DWGNIKIKNGMTLLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD 199          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_MOUSE (Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus musculus GN=Usp14 PE=1 SV=3)

HSP 1 Score: 179.104 bits (453), Expect = 1.925e-44
Identity = 89/198 (44.95%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL-HNGTFMQXD 687
            + +V+VKW KE F  VE++T + P VFK QL+ LTGV P RQK+MVKGG LKDD DW  + +K G  ++MMG+AD + + P    VFVED+ EE+   ++    GL NLGNTCYMN+T+QC+ SVPELK AL +Y+ + R++    S+  +T A  +LF+ +DK+   + P+     L   +PQF +    G ++Q D
Sbjct:    3 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD-DWGNIKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD 199          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_RABIT (Ubiquitin carboxyl-terminal hydrolase 14 OS=Oryctolagus cuniculus GN=USP14 PE=1 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 2.515e-44
Identity = 88/198 (44.44%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL-HNGTFMQXD 687
            + +V+VKW KE F  VE++T + P VFK QL+ LTGV P RQ++MVKGG LKDD DW  + +K G  ++MMG+AD + + P    VFVED+ EE+   ++    GL NLGNTCYMN+T+QC+ SVPELK AL +Y+ + R++    S+  +T A  +LF+ +DK+   + P+     L   +PQF +    G ++Q D
Sbjct:    3 LYSVTVKWGKEKFGGVELNTDEPPMVFKAQLFALTGVQPARQRVMVKGGTLKDD-DWGNIKIKNGMTILMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD 199          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_BOVIN (Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos taurus GN=USP14 PE=2 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 2.515e-44
Identity = 89/198 (44.95%), Postives = 128/198 (64.65%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL-HNGTFMQXD 687
            + +V+VKW KE F  VE++T + P VFK QL+ LTGV P RQK+MVKGG LKDD DW  + +K G  ++MMG+AD + + P    VFVED+ EE+   ++    GL NLGNTCYMN+T+QC+ SVPELK AL +Y+ + R++    S+  +T A  +LF+ +DK+   + P+     L   +PQF +    G ++Q D
Sbjct:    3 LYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDD-DWGNIKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQD 199          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP6_SCHPO (Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizosaccharomyces pombe GN=ubp6 PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.295e-32
Identity = 80/199 (40.20%), Postives = 118/199 (59.30%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSNDVDQSSHMLTVATSELFNDLDKSVKPVAPMQFWMLLRKKYPQFGQL--HNGTFMQXD 687
            M+ ++++WQ + + ++EI+ ++T    K QLY LT VPPERQK++VKGG LKDD     +G+K    L+MMGTA E+   P   P+   +  E+E+    G+ +GL NLGNTCYMNST+Q L ++PEL  A+ +++ SG           L      L N + +S  PV PM+F   LR +YPQF ++    G + Q D
Sbjct:    1 MIPIAIRWQGKKY-DLEIEPNETGSTLKHQLYSLTQVPPERQKVIVKGGQLKDDVLLGSVGIKPNATLLMMGTAGEL---PTAMPIPAVESVEQEESEDDGYPSGLINLGNTCYMNSTVQMLRAIPELSDAVSQFNSSGG----------LVAEYRTLLNSM-QSNAPVTPMRFLQSLRMEYPQFAEMSRETGGYAQQD 184          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP14_CAEEL (Ubiquitin carboxyl-terminal hydrolase 14 OS=Caenorhabditis elegans GN=usp-14 PE=2 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 1.298e-24
Identity = 73/190 (38.42%), Postives = 106/190 (55.79%), Query Frame = 1
Query:   97 MLTVSVKWQKEVFSNVEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTADEIVKAPEKGPVFVEDLPEEEQVLSLGHSAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQSGRSND-VDQSSHMLTVATSELFNDLDKSVK----PVAPMQFWMLLRKKYPQF 651
            M  V+VKWQKE +  VE+DTS  P VFK QL+ LT V PERQK+++ G  L DD DW  + +K+   +MMMG+  EI K P        +  ++ + +S  +  GL NLGNTCY NS +Q L  V EL   ++K ++  R  +  D+  H L    + L  D D++++    P+ P    + L   +PQF
Sbjct:    1 MPIVNVKWQKEKYV-VEVDTSAPPMVFKAQLFALTQVVPERQKVVIMGRTLGDD-DWEGITIKENMTIMMMGSVGEIPKPPTVLEKKQANRDKQAEEISALYPCGLANLGNTCYFNSCVQMLKEVNEL---VLKPAEEMRIREHNDRLCHNLATLFNSL-RDKDRALRSKGEPIKPFAAILTLSDSFPQF 184          
BLAST of FC875590 vs. ExPASy Swiss-Prot
Match: UBP6_YEAST (Ubiquitin carboxyl-terminal hydrolase 6 OS=Saccharomyces cerevisiae GN=UBP6 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.754e-21
Identity = 67/191 (35.08%), Postives = 99/191 (51.83%), Query Frame = 1
Query:  142 VEIDTSQTPYVFKCQLYDLTGVPPERQKIMVKGGLLKDDSDWSMLGVKQGQRLMMMGTAD-EIVKAPEKGPVFVEDLPEEEQVLSLGH-SAGLFNLGNTCYMNSTIQCLHSVPELKSALIKYSQS---GRSNDVDQSSH-MLTVATSELFNDL-DKSVKPVAPMQFWMLLRKKYPQFGQ--LHNGTFMQXD 687
            + + T  T    K +  +LT VP  RQK MVKGGL  ++S      +K G  +M++GT D  ++  P K   F+EDL  E+QV        G  N+GNTCY+N+T+Q L+ V +L+  ++ Y+ S     S   D+  H  + +     F +L +KS K V P+     LRK YPQF +     G + Q D
Sbjct:   19 ITLSTDATSADLKSKAEELTQVPSARQKYMVKGGLSGEESIKIYPLIKPGSTVMLLGTPDANLISKPAKKNNFIEDLAPEQQVQQFAQLPVGFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEIHKQIVIEMKRCFENLQNKSFKSVLPIVLLNTLRKCYPQFAERDSQGGFYKQQD 209          
The following BLAST results are available for this feature:
BLAST of FC875590 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
UBP7_ARATH5.351e-8779.19Ubiquitin carboxyl-terminal hydrolase 7 OS=Arabido... [more]
UBP6_ARATH3.039e-8275.63Ubiquitin carboxyl-terminal hydrolase 6 OS=Arabido... [more]
UBP14_PANTR6.618e-4545.45Ubiquitin carboxyl-terminal hydrolase 14 OS=Pan tr... [more]
UBP14_HUMAN6.618e-4545.45Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo s... [more]
UBP14_MOUSE1.925e-4444.95Ubiquitin carboxyl-terminal hydrolase 14 OS=Mus mu... [more]
UBP14_RABIT2.515e-4444.44Ubiquitin carboxyl-terminal hydrolase 14 OS=Orycto... [more]
UBP14_BOVIN2.515e-4444.95Ubiquitin carboxyl-terminal hydrolase 14 OS=Bos ta... [more]
UBP6_SCHPO1.295e-3240.20Ubiquitin carboxyl-terminal hydrolase 6 OS=Schizos... [more]
UBP14_CAEEL1.298e-2438.42Ubiquitin carboxyl-terminal hydrolase 14 OS=Caenor... [more]
UBP6_YEAST1.754e-2135.08Ubiquitin carboxyl-terminal hydrolase 6 OS=Sacchar... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31405F04EF CTVClemen1 Citrus clementina cDNA clone C31405F04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875590 ID=FC875590|Name=FC875590|organism=Citrus clementina|type=EST|length=689bp
GGTCCAAGGCTCCAAGCCATAAACAAAAACCGAAAAACCGAACTGTTCAA
AAACCCATTTACACATTTTTCTCGATTTCTCTAAGCCTCTTCAATCATGC
TAACAGTGAGTGTGAAATGGCAAAAGGAGGTCTTTTCGAATGTGGAAATT
GACACTAGCCAGACCCCTTATGTTTTCAAGTGTCAATTGTATGATCTGAC
TGGTGTGCCACCAGAAAGGCAGAAGATTATGGTAAAGGGCGGTTTACTGA
AGGATGATTCAGATTGGTCAATGTTAGGAGTGAAACAGGGTCAAAGATTG
ATGATGATGGGAACAGCAGATGAGATTGTGAAGGCTCCTGAGAAGGGACC
TGTTTTTGTGGAAGATCTTCCTGAAGAAGAACAAGTGTTATCACTGGGTC
ATAGTGCTGGCCTGTTCAATTTGGGAAACACCTGCTACATGAACTCCACC
ATCCAGTGCCTGCATTCTGTTCCAGAGTTGAAGTCTGCTTTAATTAAGTA
TTCACAGTCTGGAAGAAGCAATGATGTGGATCAAAGCTCTCATATGTTGA
CAGTTGCTACTTCTGAATTATTTAATGATCTTGATAAAAGTGTGAAGCCT
GTGGCTCCTATGCAGTTTTGGATGCTGTTGCGTAAAAAGTATCCTCAGTT
TGGCCAGTTGCACAATGGTACCTTCATGCAGCANGATGC
back to top