FC875592

Overview
NameFC875592
Unique NameFC875592
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:372..1041. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 3.380e-107
Identity = 187/209 (89.47%), Postives = 197/209 (94.26%), Query Frame = 2
Query:   53 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MATSTMALSSS F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFA
Sbjct:    1 MATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFA 209          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.678e-106
Identity = 185/209 (88.52%), Postives = 197/209 (94.26%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA STMALSS SF GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAASTMALSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA 209          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 1.678e-106
Identity = 183/208 (87.98%), Postives = 195/208 (93.75%), Query Frame = 2
Query:   53 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA 208          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.855e-105
Identity = 183/207 (88.41%), Postives = 193/207 (93.24%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA +TMALSS SF G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA 207          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.855e-105
Identity = 181/207 (87.44%), Postives = 194/207 (93.72%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA +TMALSS SF G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA 207          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 3.164e-105
Identity = 181/208 (87.02%), Postives = 194/208 (93.27%), Query Frame = 2
Query:   53 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFA 208          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.132e-105
Identity = 182/209 (87.08%), Postives = 197/209 (94.26%), Query Frame = 2
Query:   53 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA +TMALSSS F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFA
Sbjct:    1 MAAATMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFA 209          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 7.048e-105
Identity = 183/209 (87.56%), Postives = 194/209 (92.82%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            M  STMALSS SF G AV L+PS +E++  G+  MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDPEAFA
Sbjct:    1 MTASTMALSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 209          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 3.498e-104
Identity = 183/209 (87.56%), Postives = 192/209 (91.87%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSK--SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA+STMALSS S  GKAV L P+ +E+   GRI+MRKT  K  +V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFA
Sbjct:    1 MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFA 209          
BLAST of FC875592 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 4.568e-104
Identity = 182/209 (87.08%), Postives = 194/209 (92.82%), Query Frame = 2
Query:   53 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFA 670
            MA +TMALSS SF GKAV  +PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFA
Sbjct:    1 MAAATMALSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFA 209          
The following BLAST results are available for this feature:
BLAST of FC875592 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
CB2G_SOLLC3.380e-10789.47Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC1.678e-10688.52Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC1.678e-10687.98Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2B_SOLLC1.855e-10588.41Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_TOBAC1.855e-10587.44Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB25_NICPL3.164e-10587.02Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB25_TOBAC4.132e-10587.08Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB27_TOBAC7.048e-10587.56Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB2A_SPIOL3.498e-10487.56Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB25_PETSP4.568e-10487.08Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F06EF CTVClemen1 Citrus clementina cDNA clone C31405F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875592 ID=FC875592|Name=FC875592|organism=Citrus clementina|type=EST|length=670bp
ACCTCTCAACACTCGAACACTAGAGCCCACCAACAACTCTGATCATTGCA
AAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGCT
GTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCTC
CATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTACG
GCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAGC
TACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGCT
TTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATCC
ACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCTC
TTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGGG
AGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGCT
TGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTTG
ATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAGT
GACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCTG
ATGACCCGGAGGCTTTTGCT
back to top