FC875593

Overview
NameFC875593
Unique NameFC875593
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length754
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13233 contig Ccv1_Contig13233:240..994. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_ARATH (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Arabidopsis thaliana GN=At2g20420 PE=1 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.698e-116
Identity = 204/244 (83.61%), Postives = 229/244 (93.85%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +WQ QQLRRLNIHEYQGAELM KYG+NVPKG+A +S++EVKKA QDVFP+  ELVVKSQILAGGRGLGTFKSGLKGGVHIVK++E E++AGKMLGQ+LVTKQTGPQGK+VSKVYLCEKLSLVNEMYF+I+LDRK+AGP+II C KGGTSIEDLAEK+P+MI+KVPIDVF GITDEDAAKVVDGLAPK ADR D+IEQVKKLY+LF ++DCT+LEINPLAETS  QLVAADAKLNFDDNAAFRQK
Sbjct:   18 KWQNQQLRRLNIHEYQGAELMGKYGVNVPKGVAASSLEEVKKAIQDVFPNESELVVKSQILAGGRGLGTFKSGLKGGVHIVKRDEAEEIAGKMLGQVLVTKQTGPQGKVVSKVYLCEKLSLVNEMYFSIILDRKSAGPLIIACKKGGTSIEDLAEKFPDMIIKVPIDVFAGITDEDAAKVVDGLAPKAADRKDSIEQVKKLYELFRKTDCTMLEINPLAETSTNQLVAADAKLNFDDNAAFRQK 261          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_ORYSJ (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Oryza sativa subsp. japonica GN=Os02g0621700 PE=1 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 9.317e-115
Identity = 204/244 (83.61%), Postives = 221/244 (90.57%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            +WQ QQLRRLNIHEYQGAELM KYGINVP+G A  SV+EVK   ++VFP  KE+VVKSQILAGGRGLGTFKSGL+GGVHIVK EE E LA KMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAI LDR TAGP+II CSKGGTSIEDLAEKYP+MI+KVPIDVF GITD+DAAKVVDGLAPK ADR  +IEQ+KKLY+LFC+SDCTLLEINPLAET+  +LVAADAKLNFDDNAAFRQK
Sbjct:   19 KWQHQQLRRLNIHEYQGAELMGKYGINVPRGAAAGSVEEVKNTLKNVFPSEKEIVVKSQILAGGRGLGTFKSGLQGGVHIVKAEEAESLAAKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAITLDRNTAGPLIIACSKGGTSIEDLAEKYPDMIIKVPIDVFKGITDDDAAKVVDGLAPKTADRQSSIEQIKKLYELFCKSDCTLLEINPLAETADNKLVAADAKLNFDDNAAFRQK 262          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_DICDI (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsC PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 3.046e-57
Identity = 115/238 (48.32%), Postives = 158/238 (66.39%), Query Frame = 2
Query:   17 QLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFR 727
            Q R LN+HEYQ  ++M  YGIN P G    + +E +K  + +  + ++LVVK+Q+LAGGRG G F SGLKGGV +    E+V+  A KMLG  LVTKQTG  GK+V +VY+ E+  L  EMYFAI++DRK  GP+++   +GG  IE +A   P+ I K PID+  G+  E   ++ + L     + + A +Q+KKLY  F ++DCTL+EINPLAET+   ++  DAKLNFDDNAAFR
Sbjct:   31 QKRFLNVHEYQAQKMMKSYGINCPVGNVAETPEEAEKIAEVM--NTQDLVVKAQVLAGGRGKGIFTSGLKGGVQLCSSAEDVKKFASKMLGHTLVTKQTGEDGKVVHQVYVTERHFLRKEMYFAILMDRKAGGPVMVASPEGGVDIEGVARDNPSAIFKEPIDIMIGVQPEQTKRLAEKLGFSKKNISMAQDQMKKLYDFFIKNDCTLVEINPLAETASGDVLCMDAKLNFDDNAAFR 266          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_PIG (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial (Fragment) OS=Sus scrofa GN=SUCLA2 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.864e-55
Identity = 113/248 (45.56%), Postives = 163/248 (65.73%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            Q QQQQ R L++HEY   EL+ + G+++PKG    S DE     + +    K++V+K+Q+LAGGRG GTF+SGLKGGV IV   EE + ++ +M+G+ L TKQTG +G+I ++V +CE+     E YFAI ++R   GP++IG S+GG +IED+A + P  IVK PID+  GI  E A ++    G  P + D   A E + KLY LF + D T++EINP+ E S   ++  DAK+NFD N+A+RQK+
Sbjct:    6 QIQQQQQRNLSLHEYMSMELLQEAGVSIPKGHVAKSPDEAYAIAKKL--GSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERRYPRREYYFAITMERSFQGPVLIGSSQGGVNIEDVAAETPEAIVKEPIDIVEGIKKEQAVRLAQKMGFPPSIVD--SAAENMIKLYNLFLKYDATMVEINPMVEDSDGAVLCMDAKINFDSNSAYRQKK 249          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_MOUSE (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Mus musculus GN=Sucla2 PE=1 SV=2)

HSP 1 Score: 212.616 bits (540), Expect = 1.848e-54
Identity = 113/248 (45.56%), Postives = 162/248 (65.32%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            Q QQQQ R L++HEY   EL+ + G++VPKG    S DE     + +    K++V+K+Q+LAGGRG GTF SGLKGGV IV   EE + ++ +M+GQ L+TKQTG +G+I ++V +CE+     E YFAI ++R   GP++IG ++GG +IED+A + P  IVK PID+  GI  E A  +    G    + D   A E + KLY LF + D T++EINP+ E S  +++  DAK+NFD N+A+RQK+
Sbjct:   44 QVQQQQQRTLSLHEYLSMELLQEAGVSVPKGFVAKSSDEAYAIAKKL--GSKDVVIKAQVLAGGRGKGTFTSGLKGGVKIVFSPEEAKAVSSQMIGQKLITKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSAQGGVNIEDVAAENPEAIVKEPIDIVEGIKKEQAVTLAQKMGFPSNIVD--SAAENMIKLYNLFLKYDATMVEINPMVEDSDGKVLCMDAKINFDSNSAYRQKK 287          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_HUMAN (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens GN=SUCLA2 PE=1 SV=3)

HSP 1 Score: 212.231 bits (539), Expect = 2.414e-54
Identity = 112/248 (45.16%), Postives = 162/248 (65.32%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            Q QQQQ R L++HEY   EL+ + G++VPKG    S DE     + +    K++V+K+Q+LAGGRG GTF+SGLKGGV IV   EE + ++ +M+G+ L TKQTG +G+I ++V +CE+     E YFAI ++R   GP++IG S GG +IED+A + P  I+K PID+  GI  E A ++    G  P + +   A E + KLY LF + D T++EINP+ E S   ++  DAK+NFD N+A+RQK+
Sbjct:   44 QVQQQQQRNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKL--GSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESPEAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVE--SAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKK 287          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_MACFA (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Macaca fascicularis GN=SUCLA2 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 7.023e-54
Identity = 110/248 (44.35%), Postives = 162/248 (65.32%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVD--GLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            Q QQQQ R L++HEY   EL+ + G+++PKG    S DE     + +    K++V+K+Q+LAGGRG GTF+SGLKGGV IV   EE + ++ +M+G+ L TKQTG +G+I ++V +CE+     E YFAI ++R   GP++IG S+GG +IED+A + P  I+  PID+  GI  E A ++    G  P + +   A E + KLY LF + D T++EINP+ E S   ++  DAK+NFD N+A+RQK+
Sbjct:   44 QVQQQQQRNLSLHEYMSMELLQEAGVSIPKGCVAKSPDEAYAVAKKL--GSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSQGGVNIEDVAAETPEAIITEPIDIEEGIKKEQALQLAQKMGFPPNIVE--SAAENMVKLYSLFLKYDATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKK 287          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB_NEUCR (Probable succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Neurospora crassa GN=B9J10.140 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.565e-53
Identity = 108/241 (44.81%), Postives = 156/241 (64.73%), Query Frame = 2
Query:   11 QQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQ 730
            QQQ R L+IHEY  A+L+ +YGI VPKG    +  E +   + +    +++V+K+Q+LAGGRG GTF +GLKGGV ++    E +  A +M+G  L+TKQTG QG++ S VY+CE+     E Y A+++DR + GP+I+  S+GG  IE +A++ P  I    ID+  G+TDE A  +   L        +A + ++KLYK+FCE D T +EINPL+ETS  +++A DAK  FDDNA FRQ
Sbjct:   31 QQQRRALSIHEYLSADLLRQYGIGVPKGDVARTGAEAEAIAKQI--GGEDMVIKAQVLAGGRGKGTFDNGLKGGVRVIYSPTEAKMFAEQMIGHKLITKQTGAQGRLCSAVYICERKFARREFYLAVLMDRASQGPVIVSSSQGGMDIEGVAKENPEAIHTTYIDINVGVTDEMARDIATKLGFSEQCVEEAKDTIQKLYKIFCEKDATQIEINPLSETSDHKVMAMDAKFGFDDNADFRQ 269          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB2_DICDI (Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Dictyostelium discoideum GN=scsB PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.324e-52
Identity = 112/241 (46.47%), Postives = 154/241 (63.90%), Query Frame = 2
Query:   17 QLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTF-KSGLKGGVHIVKK-EEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQK 733
            Q+R LN+HEYQ   LM KYG+N  K   V    +  KA  ++   + ELVVK+Q+ AGGRG G+F ++G KGGVH+ K  +E E L  +MLG+ LVTKQT  +G  V  V L E +    E+YFAI++DRK  GP++I   +GG  IE +AE+ P++I K PID+  GI  E    + + L         A +Q++ LY+LF +SD T +EINP AET+  Q++  DAK+NFDDNA+FRQK
Sbjct:   23 QVRYLNLHEYQSKSLMDKYGVNTQKWRVVTKASDAIKAASEL---NGELVVKAQVHAGGRGKGSFIETGFKGGVHLCKTGKEAERLCDEMLGKHLVTKQTTKEGTKVQSVMLAESVDPKRELYFAIVMDRKYGGPVMIASPQGGVDIESVAEETPDLIFKEPIDIVKGIRPEQTKNLAEKLGFTGEKAKIAQQQMENLYQLFIKSDATQVEINPFAETTDGQVICMDAKINFDDNASFRQK 260          
BLAST of FC875593 vs. ExPASy Swiss-Prot
Match: SUCB1_BOVIN (Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Bos taurus GN=SUCLA2 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.324e-52
Identity = 108/246 (43.90%), Postives = 159/246 (64.63%), Query Frame = 2
Query:    2 QWQQQQLRRLNIHEYQGAELMAKYGINVPKGLAVASVDEVKKATQDVFPDHKELVVKSQILAGGRGLGTFKSGLKGGVHIV-KKEEVEDLAGKMLGQILVTKQTGPQGKIVSKVYLCEKLSLVNEMYFAIMLDRKTAGPIIIGCSKGGTSIEDLAEKYPNMIVKVPIDVFNGITDEDAAKVVDGLAPKVADRNDAIEQVKKLYKLFCESDCTLLEINPLAETSGKQLVAADAKLNFDDNAAFRQKR 736
            Q Q QQ R L++HEY   EL+ + G+++PKG    S DE     + +    K++V+K+Q+LAGGRG GTF+SGLKGGV IV   EE + ++ +M+G+ L TKQTG +G+I ++V +CE+     E YFAI ++R   GP++IG S GG +IED+A + P  IVK PID+  GI  E A ++   +    +  + A E + KLY  F + D T++EINP+ E S   ++  DAK+NFD N+A+RQK+
Sbjct:   44 QIQHQQQRNLSLHEYLSMELLQEAGVSIPKGHVAKSPDEAYAIAKKL--GSKDVVIKAQVLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGRICNQVLVCERRYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAETPEAIVKEPIDIVEGIKKEQAVRLAQKMGFPASIVDSAAENMIKLYDPFLKYDATMVEINPMVEDSDGAVLCMDAKINFDSNSAYRQKK 287          
The following BLAST results are available for this feature:
BLAST of FC875593 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
SUCB_ARATH1.698e-11683.61Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB_ORYSJ9.317e-11583.61Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB1_DICDI3.046e-5748.32Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCB1_PIG4.864e-5545.56Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCB1_MOUSE1.848e-5445.56Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCB1_HUMAN2.414e-5445.16Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCB1_MACFA7.023e-5444.35Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]
SUCB_NEUCR1.565e-5344.81Probable succinyl-CoA ligase [GDP-forming] subunit... [more]
SUCB2_DICDI1.324e-5246.47Succinyl-CoA ligase [GDP-forming] subunit beta, mi... [more]
SUCB1_BOVIN1.324e-5243.90Succinyl-CoA ligase [ADP-forming] subunit beta, mi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F07EF CTVClemen1 Citrus clementina cDNA clone C31405F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875593 ID=FC875593|Name=FC875593|organism=Citrus clementina|type=EST|length=754bp
CCAATGGCAGCAACAGCAGCTCCGCCGTCTCAATATCCACGAATATCAGG
GGGCTGAGTTGATGGCCAAATATGGAATCAATGTGCCCAAAGGACTCGCT
GTTGCTTCTGTTGATGAAGTCAAAAAGGCTACTCAGGATGTTTTTCCCGA
TCATAAGGAGCTGGTGGTTAAGAGCCAAATTTTGGCTGGTGGGAGAGGCT
TGGGTACTTTTAAGTCTGGTCTTAAGGGTGGGGTTCACATTGTTAAGAAA
GAAGAAGTTGAAGATTTAGCTGGGAAGATGCTTGGACAGATACTTGTCAC
CAAACAAACTGGTCCACAAGGCAAAATTGTCAGCAAGGTTTATTTGTGTG
AAAAGTTGTCACTTGTCAATGAGATGTACTTTGCTATCATGTTGGATCGT
AAAACTGCTGGCCCTATAATAATTGGTTGCAGCAAGGGAGGAACCAGCAT
TGAAGACCTTGCTGAGAAATATCCTAACATGATTGTTAAGGTGCCTATTG
ATGTTTTCAATGGAATCACTGATGAAGATGCTGCTAAGGTTGTTGATGGT
TTGGCGCCCAAGGTTGCTGATAGAAATGATGCAATTGAACAAGTGAAGAA
ACTGTATAAACTCTTTTGTGAGAGTGACTGCACATTATTGGAAATCAATC
CTCTAGCAGAGACTTCTGGTAAGCAGTTGGTGGCTGCTGATGCTAAGTTG
AATTTTGATGATAATGCTGCCTTCCGTCAGAAGAGATATTTGCTCTTCGT
GACC
back to top