FC875594

Overview
NameFC875594
Unique NameFC875594
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length688
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:5..692. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 2.566e-89
Identity = 158/188 (84.04%), Postives = 169/188 (89.89%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQ+H              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K G LPDP+STDNAEFQIVLTIIRDGLK+D
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKSD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 9.752e-89
Identity = 155/188 (82.45%), Postives = 167/188 (88.83%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+ + SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+E+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE++EKTG+LPDP+STDNAE QIVLTIIRDGLK D
Sbjct:    1 MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLKTD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 1.274e-88
Identity = 154/188 (81.91%), Postives = 169/188 (89.89%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STDN EFQIVL+II++GL+ D
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 6.321e-88
Identity = 154/188 (81.91%), Postives = 168/188 (89.36%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MALSV+K+A+GRE+KVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQT VLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTDNAEFQIVL+IIRDGLK+D
Sbjct:    1 MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRDGLKSD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 8.256e-88
Identity = 155/188 (82.45%), Postives = 167/188 (88.83%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STDNAEF+IVL+II++GLK D
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLKTD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_MESCR (Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.402e-87
Identity = 154/188 (81.91%), Postives = 164/188 (87.23%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL+V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWG GGGPDLIVDDGGDATLLIHEGVKAEE YEK G +PDP STDN EFQ+VL +IRD LK D
Sbjct:    1 MALAVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDSLKVD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.137e-87
Identity = 154/188 (81.91%), Postives = 164/188 (87.23%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK D
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_PHASS (Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.137e-87
Identity = 155/188 (82.45%), Postives = 164/188 (87.23%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K+ SGRE+KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ L+WG GGGPDLIVDDGGDATLLIHEGVKAEE YEK GK+PDPASTDNAEFQIVL +IRD L  D
Sbjct:    1 MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDSLSVD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 3.137e-87
Identity = 154/188 (81.91%), Postives = 164/188 (87.23%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STDNAEFQ+VLTII++ LK D
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTD 188          
BLAST of FC875594 vs. ExPASy Swiss-Prot
Match: SAHH_WHEAT (Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.033e-86
Identity = 152/188 (80.85%), Postives = 166/188 (88.30%), Query Frame = 2
Query:  125 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKAD 688
            MALSV+K++SGRE+KVKDL QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFS+QDH              WKGETL+EYWWCTE+ LDWG GGGPDLIVDDGGDATLLIHEGVKAEE +EK+GK+PDP STDN EF+IVLTIIRDGLK D
Sbjct:    1 MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTD 188          
The following BLAST results are available for this feature:
BLAST of FC875594 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_CATRO2.566e-8984.04Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_MEDSA9.752e-8982.45Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH1_ARATH1.274e-8881.91Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_PETCR6.321e-8881.91Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_LUPLU8.256e-8882.45Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH_MESCR2.402e-8781.91Adenosylhomocysteinase OS=Mesembryanthemum crystal... [more]
SAHH_TOBAC3.137e-8781.91Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_PHASS3.137e-8782.45Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH... [more]
SAHH_NICSY3.137e-8781.91Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH_WHEAT2.033e-8680.85Adenosylhomocysteinase OS=Triticum aestivum GN=SAH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F08EF CTVClemen1 Citrus clementina cDNA clone C31405F08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875594 ID=FC875594|Name=FC875594|organism=Citrus clementina|type=EST|length=688bp
GCTCACCCCACTCTATCTCTCTCGCTTGTACAATCATTCACTTTGTTTGG
TTGGTTTCCAAAGAGAGAGTAGAGTGCCCTCTCTTCCTTCTTCCTTTTAG
ATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAATCCGC
TAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTTCGGCC
GCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGGCTTGC
CGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATCACCGG
TTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCTCACCG
CTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAACCCAA
GACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTTGCCTG
GAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGCCCTGG
ACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTGGTGAC
GCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTACGAGAA
GACCGGGAAGTTGCCCGACCCGGCCTCCACCGACAACGCCGAGTTTCAGA
TTGTTTTGACTATCATTAGAGATGGGTTGAAGGCCGAT
back to top