FC875599

Overview
NameFC875599
Unique NameFC875599
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10289 contig Ccv1_Contig10289:4..668. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875599 vs. ExPASy Swiss-Prot
Match: BPS1_ARATH (Protein BPS1, chloroplastic OS=Arabidopsis thaliana GN=BPS1 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.400e-73
Identity = 131/197 (66.50%), Postives = 163/197 (82.74%), Query Frame = 3
Query:   75 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELEFPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSSPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMY 665
            M+RPQDP R FFPFGNPF+ +S K S LS KL+ LL +FE  LA  + KL+PK+K DIL +SWM+ AMESLCETHN IK LIT+LE PVSDW++KW+DVYLDISV LLD+C AFSS LT+++QGHLLLQ  LH L+++SP    +A SSLD+W++HI SKNPR+E+CR+IL +LV +L+LPKVKNSAKGKVLMRA+Y
Sbjct:    1 MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLASSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPRIENCRAILSSLVQTLNLPKVKNSAKGKVLMRALY 197          
BLAST of FC875599 vs. ExPASy Swiss-Prot
Match: U496D_ORYSI (UPF0496 protein 4 OS=Oryza sativa subsp. indica GN=OsI_033149 PE=3 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 1.618e-53
Identity = 111/201 (55.22%), Postives = 134/201 (66.67%), Query Frame = 3
Query:   75 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELEFPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMY 665
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LE PVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  + PR+ SC + L  L  +L L KVKNS KGKVLMRA+Y
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCPRLVSCSATLQELAGNLSLMKVKNSVKGKVLMRALY 201          
BLAST of FC875599 vs. ExPASy Swiss-Prot
Match: U496D_ORYSJ (UPF0496 protein 4 OS=Oryza sativa subsp. japonica GN=Os10g0513300 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.707e-53
Identity = 111/201 (55.22%), Postives = 134/201 (66.67%), Query Frame = 3
Query:   75 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELEFPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMY 665
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LE PVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  +  R+ SC + L  L  +L L KVKNSAKGKVLMRA+Y
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCARLVSCSATLQELAGNLSLMKVKNSAKGKVLMRALY 201          
The following BLAST results are available for this feature:
BLAST of FC875599 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
BPS1_ARATH2.400e-7366.50Protein BPS1, chloroplastic OS=Arabidopsis thalian... [more]
U496D_ORYSI1.618e-5355.22UPF0496 protein 4 OS=Oryza sativa subsp. indica GN... [more]
U496D_ORYSJ4.707e-5355.22UPF0496 protein 4 OS=Oryza sativa subsp. japonica ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31405G01EF CTVClemen1 Citrus clementina cDNA clone C31405G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875599 ID=FC875599|Name=FC875599|organism=Citrus clementina|type=EST|length=665bp
GACGCAATAGTGTCTCTAACGCGTCTGCGAAATTTCCTAAGATTTTCGAG
TACTGATTTCGCAAATCCATCAAAATGAGTCGCCCCCAGGATCCACACCG
TCCTTTCTTCCCATTTGGAAATCCTTTTCGGATGATGTCCCCCAAAGGTT
CTCGTTTGTCTCCCAAGCTTGTATCTCTGTTGGCTGATTTTGAGGAGACC
TTGGCAGAGAGGCTGAGAAAACTTATGCCGAAAGACAAGGATGATATCCT
CAACTTATCATGGATGAGACTGGCAATGGAGTCACTTTGTGAGACTCACA
ATGTCATAAAAGACCTTATAACTGAGTTGGAGTTTCCTGTAAGTGACTGG
GATGAGAAATGGATAGACGTGTACTTAGACATCAGTGTAAACTTGCTTGA
TATATGCATTGCTTTTAGCTCTGTTCTCACGAAGGTCAGCCAAGGCCACC
TATTGCTTCAGTGTGTCTTGCACACTTTGGATTCTTCCTCTCCAACACAG
TTTGGGCGAGCCTGTTCTTCTCTTGATAACTGGAGGGAGCACATTAGTTC
AAAGAACCCCAGAGTTGAGAGCTGTCGTTCAATCTTAGACAATCTGGTAG
CTTCTTTGGATTTGCCCAAGGTTAAGAACTCAGCCAAAGGGAAGGTTTTG
ATGCGCGCAATGTAT
back to top