FC875600

Overview
NameFC875600
Unique NameFC875600
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length577
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875600_ssr449 microsatellite FC875600_ssr449:449..460. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig885 contig Ccv1_Contig885:17..593. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875600 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.601e-13
Identity = 35/53 (66.04%), Postives = 36/53 (67.92%), Query Frame = 2
Query:  134 GTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 292
            GTA C            GVFLKFGC  EFWICLLLT  GYIPGIIYA+YAITK
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of FC875600 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 3.601e-13
Identity = 35/53 (66.04%), Postives = 36/53 (67.92%), Query Frame = 2
Query:  134 GTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 292
            GTA C            GVFLKFGC  EFWICLLLT  GYIPGIIYA+YAITK
Sbjct:    3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55          
BLAST of FC875600 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.601e-13
Identity = 36/57 (63.16%), Postives = 39/57 (68.42%), Query Frame = 2
Query:  122 MADEGTATCXXXXXXXXXXXXGVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 292
            MAD  TATC            GVF KFGC +EFWICLLLT FGY+PGIIYAV+ ITK
Sbjct:    1 MADS-TATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56          
BLAST of FC875600 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.022e-13
Identity = 30/36 (83.33%), Postives = 35/36 (97.22%), Query Frame = 2
Query:  185 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 292
            GVFLKFGCKVEFWICL+LT+FGY+PGI+YA+Y ITK
Sbjct:   19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54          
BLAST of FC875600 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.976e-11
Identity = 28/36 (77.78%), Postives = 33/36 (91.67%), Query Frame = 2
Query:  185 GVFLKFGCKVEFWICLLLTIFGYIPGIIYAVYAITK 292
            GVFL+FGC VEFWICL+LT+ GYIPGIIYA+Y +TK
Sbjct:   19 GVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54          
The following BLAST results are available for this feature:
BLAST of FC875600 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
LTI6B_ORYSJ3.601e-1366.04Hydrophobic protein LTI6B OS=Oryza sativa subsp. j... [more]
LTI6B_ORYSI3.601e-1366.04Hydrophobic protein LTI6B OS=Oryza sativa subsp. i... [more]
LTI6A_ORYSJ3.601e-1363.16Hydrophobic protein LTI6A OS=Oryza sativa subsp. j... [more]
RCI2B_ARATH8.022e-1383.33Hydrophobic protein RCI2B OS=Arabidopsis thaliana ... [more]
RCI2A_ARATH1.976e-1177.78Hydrophobic protein RCI2A OS=Arabidopsis thaliana ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31405G02EF CTVClemen1 Citrus clementina cDNA clone C31405G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875600 ID=FC875600|Name=FC875600|organism=Citrus clementina|type=EST|length=577bp
AAGGCAGTTACTCAAATTGAAAAAACACACATTCCTTTAAAATCTTCAAT
CAAAGTTTCTTGCTTTTGACTCTTTAAATTTCACTTGATTTTTTTTTTTT
TTTTGTAAGAATCAATCAAAGATGGCAGATGAAGGCACAGCAACATGCAT
TGATATTATCTTGGCTATCATTTTGCCTCCTCTCGGTGTCTTTCTCAAAT
TTGGCTGCAAGGTTGAGTTTTGGATCTGTTTGCTGTTGACAATTTTCGGG
TATATCCCTGGAATTATTTATGCTGTTTATGCCATCACCAAGAATTGATC
TCTCTCTTCTTATTCTATGGAGAGATCTGAGGGGCAGTATGTGTTTATGA
GATTTTTATTTACAACCATTTGATGGACAGTTCTGATTTGATGTAGCCAG
ATGGATTATGATTCTTCTTTTAAGTGTTGTGTGTGCGCGTGTGTGAGAGA
GTGAGTGAGTGAAGTGTTCCTTTGTTGATCTTTAATTTTTTCCGCCCTTT
TTGTATGATTTGTCCCTTTTATGAACTTTAGTTCATTATTTTAATGTAAA
TTCCGCGACAGAAAATTTTTCTTGGGC
back to top