FC876164

Overview
NameFC876164
Unique NameFC876164
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12569 contig Ccv1_Contig12569:5..722. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876164 vs. ExPASy Swiss-Prot
Match: CND2_MOUSE (Condensin complex subunit 2 OS=Mus musculus GN=Ncaph PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.392e-24
Identity = 66/164 (40.24%), Postives = 97/164 (59.15%), Query Frame = 1
Query:  244 QILELFHNCIKLASENKINQKNTWELNLIDHLCEIIKVEEENDVE-TNFQKASCTLEAGVKIYSLRVDSVHSEAYKVLGGINRAGQENEQDTRVEDKNAHS-----VHREGYSKKDIEKKLSPLSTLESSFEALNVKKFDAAFAVDPLYHQTSAQFDESGAKGL 717
            QI E +  CIKL+SENKI  KN + L+LID + EI+K   + D E TNF+ A+ TL+A  KIY++RVD+VH++ Y+VLGG+ +       DT  + + +HS     +  E   K    KK     T+E +   +NV + D   AVDP++ +T+A FDE    G+
Sbjct:  101 QITEHYSTCIKLSSENKITTKNAFGLHLIDFMSEILK---QKDAEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGK-------DTPPQGEESHSGDGSTLETERTKKPAKPKKKQSCKTIEQNLSNINVSEADGKCAVDPMFQKTAASFDECSTTGV 254          
BLAST of FC876164 vs. ExPASy Swiss-Prot
Match: CND2_SCHPO (Condensin complex subunit 2 OS=Schizosaccharomyces pombe GN=cnd2 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.818e-24
Identity = 63/157 (40.13%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  247 ILELFHNCIKLASENKINQKNTWELNLIDHLCEIIKVEEENDVETNFQKASCTLEAGVKIYSLRVDSVHSEAYKVLGGINRAGQENEQDTRVEDKNAHSVHREGYSKKDIEKKLSPLSTLESSFEALNVKKFDAAFAVDPLYHQTSAQFDESGAKGL 717
            +L  F   IKLA++NKIN  NTW   LID+  ++  + +  D+  NFQKASCTL+  VKIY+ R+DSV +E  K+L G+    +  +Q    ED  A +   +   KK+ ++    + TL   FE++  KKF+   + DPL+ +  A FDE GAKGL
Sbjct:   67 VLSNFEEWIKLATDNKINSTNTWNFALIDYFHDMSLLRDGEDI--NFQKASCTLDGCVKIYTSRIDSVATETGKLLSGLANDSKVLQQTEEGED--AENDDEDLQKKKERKRAQRSVKTLVKDFESIRAKKFELECSFDPLFKKMCADFDEDGAKGL 219          
BLAST of FC876164 vs. ExPASy Swiss-Prot
Match: CND2_HUMAN (Condensin complex subunit 2 OS=Homo sapiens GN=NCAPH PE=1 SV=3)

HSP 1 Score: 110.923 bits (276), Expect = 6.910e-24
Identity = 66/161 (40.99%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  244 QILELFHNCIKLASENKINQKNTWELNLIDHLCEIIKVEEENDVE-TNFQKASCTLEAGVKIYSLRVDSVHSEAYKVLGGINR-AGQENEQDTRVEDKNAHSVHREGYSKKDIEKKLSPL-STLESSFEALNVKKFDAAFAVDPLYHQTSAQFDESGAKGL 717
            QI E +  CIKL++ENKI  KN + L+LID + EI+K   + D E TNF+ A+ TL+A  KIY++RVD+VH++ Y+VLGG+ + A    E +  V D +A  +   G +KK ++ K   L  T+E +   LNV + D    +DP++ +T+A FDE    G+
Sbjct:  106 QITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILK---QKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEM---GTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEIDPMFQKTAASFDECSTAGV 260          
BLAST of FC876164 vs. ExPASy Swiss-Prot
Match: CND2_XENLA (Condensin complex subunit 2 OS=Xenopus laevis GN=ncaph PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.468e-22
Identity = 56/162 (34.57%), Postives = 100/162 (61.73%), Query Frame = 1
Query:  232 LGKDQILELFHNCIKLASENKINQKNTWELNLIDHLCEIIKVEEENDVETNFQKASCTLEAGVKIYSLRVDSVHSEAYKVLGGINRAGQENEQDTRVEDKNAHSVHREGYSKKDIEKKLSPLSTLESSFEALNVKKFDAAFAVDPLYHQTSAQFDESGAKGL 717
            L   QI + +  CIKL+ ENKI  KN + L+LID++ +I+K ++     TNF+ A+ TL+A  KIY++RVD+VH++ YKVLGG+   G+E++     E++   +  ++G  +K+ +++     T+E +  ++N  + +    +DPL+ + +A FDE    G+
Sbjct:   92 LNNTQISDHYSTCIKLSQENKITTKNAFGLHLIDYMGDILKHKDSE--LTNFKVAAGTLDASAKIYAVRVDAVHADVYKVLGGL---GKESQATEDTENQETDTGPQDG--RKNPKRRKCSYKTIERNLNSINRSETERKSEIDPLFQKAAASFDEFSTAGV 246          
BLAST of FC876164 vs. ExPASy Swiss-Prot
Match: CND2_YEAST (Condensin complex subunit 2 OS=Saccharomyces cerevisiae GN=BRN1 PE=1 SV=2)

HSP 1 Score: 89.7373 bits (221), Expect = 1.649e-17
Identity = 57/177 (32.20%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  259 FHNCIKLASENKINQKNTWELNLIDHLCEIIKVEE-ENDVETNFQKASCTLEAGVKIYSLRVDSVHSEAYKVLGGINRAGQENEQDTRVEDKNAHSVHREGYSKKDIEKKLSPLSTLESS-----------------------FEALNVKKFDAAFAVDPLYHQTSAQFDESGAKGL 717
            F   IK+A++NKIN +N+W   LID+  ++  +++ EN++  NFQKAS TL+  +KIYS RVDSV +E  K+L G+  A ++    +  +D N  +    G    +   ++ PL+ +  S                       FE + +K+ D    +DPL+ +    FDE GAK L
Sbjct:   31 FEEWIKMATDNKINSRNSWNFALIDYFYDLDVLKDGENNI--NFQKASATLDGCIKIYSSRVDSVTTETGKLLSGL--AQRKTNGASNGDDSNGGNGEGLGGDSDEANIEIDPLTGMPISNDPDVNNTRRRVYNRVLETTLVEFETIKMKELDQELIIDPLFKKALVDFDEGGAKSL 203          
The following BLAST results are available for this feature:
BLAST of FC876164 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CND2_MOUSE1.392e-2440.24Condensin complex subunit 2 OS=Mus musculus GN=Nca... [more]
CND2_SCHPO1.818e-2440.13Condensin complex subunit 2 OS=Schizosaccharomyces... [more]
CND2_HUMAN6.910e-2440.99Condensin complex subunit 2 OS=Homo sapiens GN=NCA... [more]
CND2_XENLA6.468e-2234.57Condensin complex subunit 2 OS=Xenopus laevis GN=n... [more]
CND2_YEAST1.649e-1732.20Condensin complex subunit 2 OS=Saccharomyces cerev... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32001A09EF DevOvary1 Citrus clementina cDNA clone C32001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876164 ID=FC876164|Name=FC876164|organism=Citrus clementina|type=EST|length=718bp
TCGCCGGGGGATTTGAATCAAACATAGATGGCTGAAACCCTAAGTCCGCT
TCGGAGGCAGAAAGTTGCCATAGCTTCTCGCATCCAATCTCCAACCAGCC
CGTTCTTTTTGGGCTCCAATGACGACGGGCTGGAGCGAGCCAAGGCCCGC
GCGGCCCGCGCCGCCGCCATCCGCCGCAAGCCCGTCACTGTCCATTATCC
ACTGCCGCAACATGGTCACTCTGATTCCTGCCTCGGCAAGGACCAGATTC
TCGAACTGTTCCACAATTGCATCAAGCTCGCCAGCGAAAATAAAATCAAT
CAAAAGAATACATGGGAGTTGAATTTGATTGACCATCTCTGTGAGATTAT
TAAGGTTGAAGAAGAGAATGATGTGGAGACCAATTTCCAAAAGGCAAGTT
GCACTCTTGAAGCTGGAGTTAAGATTTACTCGTTAAGAGTGGATTCAGTG
CATTCAGAGGCTTACAAGGTTCTAGGGGGGATTAATAGAGCAGGTCAAGA
AAATGAACAAGACACCAGAGTGGAGGATAAAAATGCTCACAGTGTACACA
GGGAAGGTTATTCGAAGAAAGATATAGAAAAAAAGCTGTCTCCTTTATCA
ACACTGGAATCATCTTTTGAGGCACTTAATGTGAAGAAATTTGATGCTGC
ATTTGCAGTTGATCCCCTCTATCATCAAACATCTGCTCAATTCGATGAAA
GTGGAGCCAAGGGGCTCT
back to top