FC876165

Overview
NameFC876165
Unique NameFC876165
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length690
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15072 contig Ccv1_Contig15072:93..783. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_CRYCU (Glyceraldehyde-3-phosphate dehydrogenase OS=Cryptococcus curvatus GN=GPD PE=3 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 5.677e-28
Identity = 63/108 (58.33%), Postives = 69/108 (63.89%), Query Frame = 1
Query:  364 TKVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRRLQL 687
            TKVGINGFGRIGR+                NDPFID  YM YMFKYDSTHG FKG +    D  L I GK I VF +RDPA IPWG  G DYVVES+GVFTT+ +  L
Sbjct:    3 TKVGINGFGRIGRIVLRNALEHGDIDVVAINDPFIDLDYMVYMFKYDSTHGRFKGKVET-KDGKLVIEGKPISVFGERDPAAIPWGKAGADYVVESTGVFTTIEKASL 109          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P2_AGABI (Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agaricus bisporus GN=gpd2 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.683e-28
Identity = 60/102 (58.82%), Postives = 73/102 (71.57%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTL 672
            KVGINGFGRIGR+                NDPFID +YMAYMFKYDS HG FKGT+ V + S + ++G+ +KVF++RDPA IPWG  G DYVVES+GVFTT+
Sbjct:    3 KVGINGFGRIGRIVLRNALQFQDIEVVAVNDPFIDLEYMAYMFKYDSVHGRFKGTVEVKNGSFV-VDGRPMKVFAERDPAAIPWGSVGADYVVESTGVFTTI 103          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_CRIGR (Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.265e-27
Identity = 59/104 (56.73%), Postives = 70/104 (67.31%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG FKGT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAFTSGKVEVVAINDPFIDLNYMVYMFQYDSTHGKFKGTVKA-ENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEK 105          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_PHARH (Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffia rhodozyma GN=GPD PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.817e-27
Identity = 61/107 (57.01%), Postives = 71/107 (66.36%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRRLQL 687
            KVGINGFGRIGR+                NDPFID +YM YMFKYDSTHGVFKG++  + D  L I GK I V+ +RDPA I WG  G DYVVES+GVFTT  + +L
Sbjct:    4 KVGINGFGRIGRIVLRNAIIHGDIDVVAINDPFIDLEYMVYMFKYDSTHGVFKGSVE-IKDGKLVIEGKPIVVYGERDPANIQWGAAGADYVVESTGVFTTQEKAEL 109          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_PARBA (Glyceraldehyde-3-phosphate dehydrogenase OS=Paracoccidioides brasiliensis (strain ATCC MYA-826 / Pb01) GN=GPD PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.806e-27
Identity = 58/104 (55.77%), Postives = 67/104 (64.42%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVGINGFGRIGR+                NDPFI+ KY AYM KYDSTHG FKG I     + L +N K I  + +RDPA IPWG +GVDYVVES+GVFTT  +
Sbjct:    4 KVGINGFGRIGRIVFRNAVEHDDVEIVAVNDPFIETKYAAYMLKYDSTHGQFKGDIQHSSSNNLTVNNKTIHFYQERDPANIPWGKHGVDYVVESTGVFTTTEK 107          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_COTJA (Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.806e-27
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMFKYDSTHG FKGT+   ++  L ING  I +F +RDP+ I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKA-ENGKLVINGNAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEK 105          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_SPECI (Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus GN=GAPDH PE=2 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 6.276e-27
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG F GT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEK 105          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_MUSPF (Glyceraldehyde-3-phosphate dehydrogenase OS=Mustela putorius furo GN=GAPDH PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 6.276e-27
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG F GT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEK 105          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_CANFA (Glyceraldehyde-3-phosphate dehydrogenase OS=Canis familiaris GN=GAPDH PE=2 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 6.276e-27
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG F GT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKA-ENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEK 105          
BLAST of FC876165 vs. ExPASy Swiss-Prot
Match: G3P_BOVIN (Glyceraldehyde-3-phosphate dehydrogenase OS=Bos taurus GN=GAPDH PE=1 SV=4)

HSP 1 Score: 120.939 bits (302), Expect = 6.276e-27
Identity = 58/104 (55.77%), Postives = 69/104 (66.35%), Query Frame = 1
Query:  367 KVGINGFGRIGRLXXXXXXXXXXXXXXXXNDPFIDAKYMAYMFKYDSTHGVFKGTINVVDDSTLEINGKLIKVFSKRDPAEIPWGDYGVDYVVESSGVFTTLRR 678
            KVG+NGFGRIGRL                NDPFID  YM YMF+YDSTHG F GT+   ++  L INGK I +F +RDPA I WGD G +YVVES+GVFTT+ +
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLHYMVYMFQYDSTHGKFNGTVKA-ENGKLVINGKAITIFQERDPANIKWGDAGAEYVVESTGVFTTMEK 105          
The following BLAST results are available for this feature:
BLAST of FC876165 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 229
Match NameE-valueIdentityDescription
G3P_CRYCU5.677e-2858.33Glyceraldehyde-3-phosphate dehydrogenase OS=Crypto... [more]
G3P2_AGABI9.683e-2858.82Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Agar... [more]
G3P_CRIGR1.265e-2756.73Glyceraldehyde-3-phosphate dehydrogenase OS=Cricet... [more]
G3P_PHARH2.817e-2757.01Glyceraldehyde-3-phosphate dehydrogenase OS=Phaffi... [more]
G3P_PARBA4.806e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Paraco... [more]
G3P_COTJA4.806e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Coturn... [more]
G3P_SPECI6.276e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Spermo... [more]
G3P_MUSPF6.276e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Mustel... [more]
G3P_CANFA6.276e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Canis ... [more]
G3P_BOVIN6.276e-2755.77Glyceraldehyde-3-phosphate dehydrogenase OS=Bos ta... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001A10EF DevOvary1 Citrus clementina cDNA clone C32001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876165 ID=FC876165|Name=FC876165|organism=Citrus clementina|type=EST|length=690bp
ACTGCCTCCTGCCTCCTCTCGAAAGCCGCAACAACCCAAACCTCGTTAGG
GTTTTTGCGAGAAGAGAGCTCGAAACAGTGTGCTTAAGCTCAACAAATGG
CCTTCTCTTCTCTCCTCAGATCTACGGCCTCCGCTTCTCTCGTCCGCGCC
GACCTCACTTCCTCGCCGTCCGATCGCGTCAAGGGATCATCGACTGCTGC
TTTCAGTCGCAACCTTAACACTTCGAGCATTTTCGGTACTTCAGTTCCAA
GTGGTTCATCTTCTTCATCACTACAGACATGTGCTGCAAAGAGTATTCAA
CCCATCAGAGCCACAGCTACTGAAATTCCTCCAACAATTCAAAAATCACG
GAGTGATGGAAACACAAAGGTCGGAATCAATGGTTTTGGTCGGATTGGAA
GGTTGGTTTTGCGAGTAGCAGCCTTCAGGGATGATGTTGACGTTGTGGCG
GTCAATGATCCTTTTATTGATGCCAAATACATGGCTTACATGTTTAAGTA
TGATTCTACTCATGGAGTTTTCAAGGGAACCATCAATGTCGTGGATGACT
CCACCTTAGAAATTAATGGGAAGCTGATTAAAGTTTTCAGCAAAAGGGAC
CCGGCAGAGATCCCTTGGGGTGACTATGGGGTTGATTATGTTGTTGAATC
TTCTGGAGTCTTTACAACATTGCGAAGGCTTCAGCTCACA
back to top