FC876167

Overview
NameFC876167
Unique NameFC876167
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length739
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9580 contig Ccv1_Contig9580:9..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_DROME (Probable small nuclear ribonucleoprotein Sm D2 OS=Drosophila melanogaster GN=snRNP2 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 2.496e-40
Identity = 79/88 (89.77%), Postives = 83/88 (94.32%), Query Frame = 2
Query:  137 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTELP+TGKGKKK  PVNKDRFISKMFLRGDSVI+VL NP
Sbjct:   25 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNP 112          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_MOUSE (Small nuclear ribonucleoprotein Sm D2 OS=Mus musculus GN=Snrpd2 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.486e-40
Identity = 77/88 (87.50%), Postives = 84/88 (95.45%), Query Frame = 2
Query:  137 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VL NP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_HUMAN (Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens GN=SNRPD2 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.486e-40
Identity = 77/88 (87.50%), Postives = 84/88 (95.45%), Query Frame = 2
Query:  137 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VL NP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_BOVIN (Small nuclear ribonucleoprotein Sm D2 OS=Bos taurus GN=SNRPD2 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.486e-40
Identity = 77/88 (87.50%), Postives = 84/88 (95.45%), Query Frame = 2
Query:  137 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VL NP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_DICDI (Probable small nuclear ribonucleoprotein Sm D2 OS=Dictyostelium discoideum GN=snrpd2 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.798e-38
Identity = 75/87 (86.21%), Postives = 81/87 (93.10%), Query Frame = 2
Query:  140 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            GPLS+LM SV NNTQVLIN RNNKKLLGRVRAFDRHCNMVLENV+E+WTE+PKT KGKKKA P+NKDRFISKMFLRGDSVI+VL NP
Sbjct:   18 GPLSILMDSVNNNTQVLINVRNNKKLLGRVRAFDRHCNMVLENVKEIWTEVPKTAKGKKKAKPINKDRFISKMFLRGDSVILVLKNP 104          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_CAEEL (Probable small nuclear ribonucleoprotein Sm D2 OS=Caenorhabditis elegans GN=snr-4 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.755e-37
Identity = 74/87 (85.06%), Postives = 80/87 (91.95%), Query Frame = 2
Query:  140 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            GPLS+L  SVKNN QVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PKTGKGKKKA  V KDRFISKMFLRGDSVI+V+ NP
Sbjct:   27 GPLSILTNSVKNNHQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKTGKGKKKAKSVAKDRFISKMFLRGDSVILVVKNP 113          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_SCHPO (Probable small nuclear ribonucleoprotein Sm D2 OS=Schizosaccharomyces pombe GN=smd2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.678e-28
Identity = 62/87 (71.26%), Postives = 71/87 (81.61%), Query Frame = 2
Query:  140 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            GPLSVL  +VKN+ QVLINCRNNKKLL RV+AFDRH NMVLENV+EMWTE  +T  G KK   +NKDRFISKMFLRGD V++V+  P
Sbjct:   28 GPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTEKKRTASG-KKGKAINKDRFISKMFLRGDGVVLVVRIP 113          
BLAST of FC876167 vs. ExPASy Swiss-Prot
Match: SMD2_YEAST (Small nuclear ribonucleoprotein Sm D2 OS=Saccharomyces cerevisiae GN=SMD2 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 9.862e-21
Identity = 48/87 (55.17%), Postives = 65/87 (74.71%), Query Frame = 2
Query:  140 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLSNP 400
            GP+S++  ++   T V+I+ RNN K++ RV+AFDRHCNMVLENV+E+WTE       KK    +N++RFISK+FLRGDSVI+VL  P
Sbjct:   29 GPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTE-------KKGKNVINRERFISKLFLRGDSVIVVLKTP 108          
The following BLAST results are available for this feature:
BLAST of FC876167 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SMD2_DROME2.496e-4089.77Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_MOUSE9.486e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Mus muscu... [more]
SMD2_HUMAN9.486e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Homo sapi... [more]
SMD2_BOVIN9.486e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Bos tauru... [more]
SMD2_DICDI6.798e-3886.21Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_CAEEL5.755e-3785.06Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_SCHPO1.678e-2871.26Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_YEAST9.862e-2155.17Small nuclear ribonucleoprotein Sm D2 OS=Saccharom... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32001B02EF DevOvary1 Citrus clementina cDNA clone C32001B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876167 ID=FC876167|Name=FC876167|organism=Citrus clementina|type=EST|length=739bp
GGAGCTAGCTGAGTGTTTGTCTCGTCGTCCGCCGCAGTTAGGTTGTCGTT
CAGTCTTGGCTTGAAGAAGCAAATTGTCAAACATGAGTCGGCCGATGGAG
GAAGATAATGTCAAAAATGAGGAAGAGGAATTCAACACAGGTCCACTTTC
TGTTTTGATGATGAGTGTTAAAAACAATACCCAGGTGCTTATTAACTGTC
GGAACAACAAGAAGCTTCTTGGTCGTGTGAGAGCTTTTGATCGTCACTGC
AATATGGTTCTTGAGAATGTCAGGGAGATGTGGACTGAGTTGCCTAAGAC
TGGGAAAGGCAAGAAAAAGGCTCTTCCAGTTAACAAGGATAGATTCATCA
GTAAGATGTTTCTCCGAGGAGATTCTGTGATCATTGTTCTTAGCAATCCC
AAGTGAAGTACACACCTAGCTTGACAGCCTCAGCAATTTTAACGAAAGAT
CTATATGGACAATACTGTTTGTGATGGGTAAAAAATGAGCCAGCAAGCCT
AGATTTGTTTGAAGGATGTTCGCATGGTATTTGTGCAATTGTGCTGCCAA
GTTTGGGAGATTGGTTGGAGTATCTTAGGTGTCCTGACATAAGGGTGACT
TTTTTGGTGTGTTGTAAATTCAATGGACTAGAGATGTTATGGTGTGTAGC
TCTTTACTATTTTCTACTTCTAATGCTCGTTTACTTTTATTAAATCTTGA
TCTGTAATATTGAGCCATAAGCCTTGTGATTCCCTACTC
back to top