FC876169

Overview
NameFC876169
Unique NameFC876169
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length736
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LUC7L_MOUSE (Putative RNA-binding protein Luc7-like 1 OS=Mus musculus GN=Luc7l PE=2 SV=2)

HSP 1 Score: 102.064 bits (253), Expect = 3.364e-21
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 2
Query:  104 MRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKRADKQ 607
            MR  LD LMG  R+GD      K+ D  VC+ +L   CPH++   T+MD+G C K+H L LR +YE A  +    ++ +  D ++  I ECDR+   A KRL +   + +  +S     +  +V EL+++I + L +A+Q   EG  D   + L  VE++R K+ + +
Sbjct:    7 MRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS----AKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAE 170          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LUC7L_HUMAN (Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens GN=LUC7L PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.364e-21
Identity = 57/168 (33.93%), Postives = 92/168 (54.76%), Query Frame = 2
Query:  104 MRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKRADKQ 607
            MR  LD LMG  R+GD      K+ D  VC+ +L   CPH++   T+MD+G C K+H L LR +YE A  +    ++ +  D ++  I ECDR+   A KRL +   + +  +S     +  +V EL+++I + L +A+Q   EG  D   + L  VE++R K+ + +
Sbjct:    7 MRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS----AKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAE 170          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L2_HUMAN (Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens GN=LUC7L2 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 9.787e-21
Identity = 56/170 (32.94%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  104 MRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKRADKQSM 613
            MR  LD LMG +R+GD      K+ D  VC+ +L   CPH++   T+MD+G C KVH L LR +YE A  +    ++ +  D +   I +CDR+   A KRL    A+    IS     +   V EL+++I + L + +Q   EG  +   + ++ VE+ R K+ + + +
Sbjct:    7 MRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRL----AETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEV 172          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L2_MOUSE (Putative RNA-binding protein Luc7-like 2 OS=Mus musculus GN=Luc7l2 PE=1 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.180e-20
Identity = 55/170 (32.35%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  104 MRKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKRADKQSM 613
            MR  LD LMG +R+GD      K+ D  VC+ +L   CPH++   T+MD+G C KVH L LR +YE A  +    ++ +  D +   I +CDR+   + KRL    A+    IS     +   V EL+++I + L + +Q   EG  +   + ++ VE+ R K+ + + +
Sbjct:    7 MRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRL----AETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEV 172          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LUC7L_DICDI (Luc7-like protein OS=Dictyostelium discoideum GN=crop PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.665e-18
Identity = 60/198 (30.30%), Postives = 100/198 (50.51%), Query Frame = 2
Query:   95 MDAMRKQLDVLMGANRN---GDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKM-DMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRL---------------------EDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKRADKQSM 613
            MDA+R QLD  +G +RN    D  +V   + D D+C+ +L GLCPHELF    + D+GPC K+H     K+Y+  K K   +Y+RE    I+ LI + D+KI R  +RL                     + DD +  +   + +  Q  ++ EL  +I+E LK+A++   EG+       +   +EL+ ++ + + +
Sbjct:    1 MDAIRAQLDEFLGKDRNLLPKDRIKVENDFNDPDICKFFLCGLCPHELFTNANIRDLGPCSKLHDENCVKQYQNNKDKDKYDYEREWVRVIEGLISDNDKKIKRNKERLLQNPNGDANHHGGPIQQQSISQLDDEEGGL---LPDKEQNSKITELDLKIQELLKKAEELGEEGQITEAQALMTEADELKNQKVELEKI 195          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L3_PONAB (Luc7-like protein 3 OS=Pongo abelii GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.120e-16
Identity = 50/162 (30.86%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  116 LDVLMGANRN--GDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKR 595
            LD LMG +RN   D +  N ++    VC+ YL G CP ELF  T+ D+GPC K+H   LRK+YE++       Y+R+    +  L+ E +R+I R   RL     + +   +        ++  L+ +I   L++ ++   EGK +     +++VE+L+ +R
Sbjct:    8 LDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEER 169          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L3_MOUSE (Luc7-like protein 3 OS=Mus musculus GN=Luc7l3 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.120e-16
Identity = 50/162 (30.86%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  116 LDVLMGANRN--GDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKR 595
            LD LMG +RN   D +  N ++    VC+ YL G CP ELF  T+ D+GPC K+H   LRK+YE++       Y+R+    +  L+ E +R+I R   RL     + +   +        ++  L+ +I   L++ ++   EGK +     +++VE+L+ +R
Sbjct:    8 LDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEER 169          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L3_HUMAN (Luc7-like protein 3 OS=Homo sapiens GN=LUC7L3 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.120e-16
Identity = 50/162 (30.86%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  116 LDVLMGANRN--GDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKR 595
            LD LMG +RN   D +  N ++    VC+ YL G CP ELF  T+ D+GPC K+H   LRK+YE++       Y+R+    +  L+ E +R+I R   RL     + +   +        ++  L+ +I   L++ ++   EGK +     +++VE+L+ +R
Sbjct:    8 LDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEER 169          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LC7L3_BOVIN (Luc7-like protein 3 OS=Bos taurus GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.120e-16
Identity = 50/162 (30.86%), Postives = 85/162 (52.47%), Query Frame = 2
Query:  116 LDVLMGANRN--GDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLEDDDAKAAIAISVSEVTQTPEVLELSKQIKEKLKEADQYDYEGKTDLKIRALEVVEELRTKR 595
            LD LMG +RN   D +  N ++    VC+ YL G CP ELF  T+ D+GPC K+H   LRK+YE++       Y+R+    +  L+ E +R+I R   RL     + +   +        ++  L+ +I   L++ ++   EGK +     +++VE+L+ +R
Sbjct:    8 LDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEER 169          
BLAST of FC876169 vs. ExPASy Swiss-Prot
Match: LUC7_SCHPO (U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe GN=usp106 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.238e-15
Identity = 39/102 (38.24%), Postives = 63/102 (61.76%), Query Frame = 2
Query:  107 RKQLDVLMGANRNGDVREVNRKYYDRDVCRLYLAGLCPHELFQLTKMDMGPCPKVHSLQLRKEYEEAKAKGVDNYDRELEDAIDRLIVECDRKIGRALKRLE 412
            RK ++ LMG+N +         + DR VCR +L G+CPH++F  TKMD+GPCPK+HS +L+ +YE A       Y+ +  + ++R + +C+++I  A  R E
Sbjct:    6 RKIIEQLMGSNLSNFTSRGLVHFTDRKVCRSFLCGICPHDIFTNTKMDLGPCPKIHSDKLKSDYERASYSHDYGYEWDYLEDLERHVDDCNKRIDIAEARRE 107          
The following BLAST results are available for this feature:
BLAST of FC876169 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
LUC7L_MOUSE3.364e-2133.93Putative RNA-binding protein Luc7-like 1 OS=Mus mu... [more]
LUC7L_HUMAN3.364e-2133.93Putative RNA-binding protein Luc7-like 1 OS=Homo s... [more]
LC7L2_HUMAN9.787e-2132.94Putative RNA-binding protein Luc7-like 2 OS=Homo s... [more]
LC7L2_MOUSE2.180e-2032.35Putative RNA-binding protein Luc7-like 2 OS=Mus mu... [more]
LUC7L_DICDI2.665e-1830.30Luc7-like protein OS=Dictyostelium discoideum GN=c... [more]
LC7L3_PONAB1.120e-1630.86Luc7-like protein 3 OS=Pongo abelii GN=LUC7L3 PE=2... [more]
LC7L3_MOUSE1.120e-1630.86Luc7-like protein 3 OS=Mus musculus GN=Luc7l3 PE=1... [more]
LC7L3_HUMAN1.120e-1630.86Luc7-like protein 3 OS=Homo sapiens GN=LUC7L3 PE=1... [more]
LC7L3_BOVIN1.120e-1630.86Luc7-like protein 3 OS=Bos taurus GN=LUC7L3 PE=2 S... [more]
LUC7_SCHPO1.238e-1538.24U1 snRNP-associated protein usp106 OS=Schizosaccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B05EF DevOvary1 Citrus clementina cDNA clone C32001B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876169 ID=FC876169|Name=FC876169|organism=Citrus clementina|type=EST|length=736bp
GGTGGCTCTTGGGTCTTGTCTATTAACTCCAAAATCTCGAAAGCTCACAA
ACCCTAGTTCTGAGTCTCGAGTGCTCGACTCTCATTCTGACAAAATGGAC
GCAATGAGGAAGCAACTAGACGTCCTGATGGGAGCCAATCGAAACGGCGA
CGTACGAGAAGTTAATCGCAAGTACTACGATCGCGATGTTTGCCGTCTCT
ACTTGGCCGGACTTTGCCCTCACGAGCTCTTCCAATTAACGAAAATGGAT
ATGGGGCCATGTCCGAAGGTTCATTCTTTGCAGTTGCGAAAAGAATATGA
AGAAGCCAAGGCAAAAGGCGTTGATAATTATGACAGAGAATTAGAAGATG
CTATTGATAGACTTATTGTTGAGTGTGATAGGAAAATTGGTAGAGCTCTT
AAACGTCTTGAAGATGACGATGCAAAGGCTGCTATTGCTATATCAGTCTC
GGAGGTGACTCAGACTCCAGAGGTTCTTGAGTTGTCAAAACAGATCAAAG
AAAAGTTGAAAGAAGCTGATCAATATGATTATGAAGGCAAGACTGATCTT
AAGATTCGAGCTTTGGAGGTGGTAGAAGAACTCAGAACAAAAAGAGCTGA
TAAACAGTCCATGCTCCTCTTGGATGCTTTCAATAAAGATAGAGCATCGT
TGCCTCAACCCCTTCCCAACCCACCACCATTGGCACCTTTGCCAATTCCT
GCCACAGATGCTCGTACTCAGGAAATGATAAATGAA
back to top