FC876170

Overview
NameFC876170
Unique NameFC876170
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length649
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_VIGUN (Beta-amylase OS=Vigna unguiculata GN=BMY1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.334e-31
Identity = 61/121 (50.41%), Postives = 80/121 (66.12%), Query Frame = 3
Query:  285 LASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            +AS   N   N VPV+VMLPL  +S +     P  +   L+ L+ AGV+GVMVD WWG++E+ GP  Y+W  Y  L Q+V++ GLKLQ +MSFHQCGGNVGD   IP+P WVL+    +PD
Sbjct:    1 MASLDKNMLLNYVPVYVMLPLGVVSVNNVFEDPEGLKEQLVQLREAGVDGVMVDVWWGIIEQKGPKQYDWSAYKSLFQLVQECGLKLQAIMSFHQCGGNVGDVVNIPIPQWVLDIGESDPD 121          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_TRIRP (Beta-amylase OS=Trifolium repens GN=BMY1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.334e-31
Identity = 60/121 (49.59%), Postives = 82/121 (67.77%), Query Frame = 3
Query:  285 LASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            +A+   N   N VPV+VMLPL  ++ +     P  +   L+ L++AGV+GVMVD WWG++E+ GP  Y+W  Y  L Q+V++ GLKLQ +MSFHQCGGNVGD  TIP+P WVL+    +PD
Sbjct:    1 MATSNKNMLLNYVPVYVMLPLGVINVNNVFEDPDGLKEQLVQLRAAGVDGVMVDVWWGIIEQKGPKEYDWSAYKSLFQLVQECGLKLQAIMSFHQCGGNVGDVVTIPIPQWVLDIGESDPD 121          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_MEDSA (Beta-amylase OS=Medicago sativa GN=BMY1 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 6.334e-31
Identity = 60/121 (49.59%), Postives = 81/121 (66.94%), Query Frame = 3
Query:  285 LASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            +A+   N   N VPV+VMLPL  ++ +     P  +   L+ L++AGV+GVM+D WWG++E+ GP  Y+W  Y  L Q+V+K GLKLQ +MSFHQCGGNVGD   IPLP WVL+    +PD
Sbjct:    1 MATSNKNMLLNYVPVYVMLPLGVINVNNVFEDPDGLKEQLVQLRAAGVDGVMIDVWWGIIEQKGPKEYDWSAYKSLFQLVQKCGLKLQAIMSFHQCGGNVGDVVNIPLPKWVLDIGESDPD 121          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_HORVU (Beta-amylase OS=Hordeum vulgare GN=BMY1 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.143e-30
Identity = 60/111 (54.05%), Postives = 77/111 (69.37%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N V V+VMLPLD +S +    K   + A L  L  AGV+GVMVD WWGLVE  GP  Y+W  Y +L ++V+K GLKLQ +MSFHQCGGNVGD+  IP+P WV +  +++PD
Sbjct:    8 NYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPD 118          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_HORSP (Beta-amylase OS=Hordeum spontaneum GN=BMY1 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.143e-30
Identity = 60/111 (54.05%), Postives = 77/111 (69.37%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N V V+VMLPLD +S +    K   + A L  L  AGV+GVMVD WWGLVE  GP  Y+W  Y +L ++V+K GLKLQ +MSFHQCGGNVGD+  IP+P WV +  +++PD
Sbjct:    8 NYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPD 118          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_SOYBN (Beta-amylase OS=Glycine max GN=BMY1 PE=1 SV=3)

HSP 1 Score: 127.102 bits (318), Expect = 7.742e-29
Identity = 58/121 (47.93%), Postives = 77/121 (63.64%), Query Frame = 3
Query:  285 LASPPHNHHRNKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            +A+   N   N VPV+VMLPL  ++       P  +   L+ L++AGV+GVMVD WWG++E  GP  Y+W  Y  L Q+V++ GL LQ +MSFHQCGGNVGD   IP+P WVL+    N D
Sbjct:    1 MATSDSNMLLNYVPVYVMLPLGVVNVDNVFEDPDGLKEQLLQLRAAGVDGVMVDVWWGIIELKGPKQYDWRAYRSLFQLVQECGLTLQAIMSFHQCGGNVGDIVNIPIPQWVLDIGESNHD 121          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_IPOBA (Beta-amylase OS=Ipomoea batatas GN=BMY1 PE=1 SV=4)

HSP 1 Score: 125.561 bits (314), Expect = 2.253e-28
Identity = 55/111 (49.55%), Postives = 73/111 (65.77%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N V ++VMLPL  ++          +   L  +K+ G +GVMVD WWG++E  GP  Y+W  Y EL Q+VKK GLK+Q +MSFHQCGGNVGD+  IP+P W+L+   KNPD
Sbjct:   12 NYVSLYVMLPLGVVNADNVFPDKEKVEDELKQVKAGGCDGVMVDVWWGIIEAKGPKQYDWSAYRELFQLVKKCGLKIQAIMSFHQCGGNVGDAVFIPIPQWILQIGDKNPD 122          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_WHEAT (Beta-amylase OS=Triticum aestivum GN=BMY1 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.554e-28
Identity = 57/111 (51.35%), Postives = 72/111 (64.86%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N V V+VMLPLD +S      K   + A L  L  AGV+GVM+D WWGLVE  GP  Y+W  Y ++  +V + GLKLQ +MSFHQCGGNVGD   IP+P WV +  + +PD
Sbjct:    8 NYVQVYVMLPLDVVSVDNKFEKGDEIRAQLKKLTEAGVDGVMIDVWWGLVEGKGPKAYDWSAYKQVFDLVHEAGLKLQAIMSFHQCGGNVGDVVNIPIPQWVRDVGATDPD 118          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_ARATH (Beta-amylase OS=Arabidopsis thaliana GN=BMY1 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 8.560e-28
Identity = 56/112 (50.00%), Postives = 72/112 (64.29%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKS-AGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N VPV+VMLPL  ++       P  +   L  LK  AGV+GVMVD WWG++E  GP  Y+W  Y  L Q++ + GLK+Q +MSFHQCGGNVGD  TIP+P WV +    +PD
Sbjct:   12 NYVPVYVMLPLGVVNVENVFADPETLETQLKRLKEEAGVDGVMVDVWWGIIESKGPKQYDWTAYKTLFQLIARLGLKIQAIMSFHQCGGNVGDIVTIPIPQWVRDVGDNDPD 123          
BLAST of FC876170 vs. ExPASy Swiss-Prot
Match: AMYB_MAIZE (Beta-amylase OS=Zea mays GN=BMY1 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.046e-25
Identity = 54/111 (48.65%), Postives = 69/111 (62.16%), Query Frame = 3
Query:  315 NKVPVFVMLPLDTLSNSGHLNKPRAMNASLMALKSAGVEGVMVDAWWGLVEKGGPLNYNWEGYAELIQMVKKHGLKLQVVMSFHQCGGNVGDSCTIPLPPWVLEEISKNPD 647
            N V V+VMLPLD ++      K     A L  L  AG +GVM+D WWGLVE   P  Y+W  Y ++ ++V++ GLKLQ +MS HQCGGNVGD   IP+P WV +    NPD
Sbjct:    8 NYVQVYVMLPLDVITVDNTFEKEDETRAQLKKLTEAGADGVMIDVWWGLVEGKEPGVYDWSAYRQVFKLVQEAGLKLQAIMSCHQCGGNVGDVVNIPIPQWVRDVGKSNPD 118          
The following BLAST results are available for this feature:
BLAST of FC876170 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
AMYB_VIGUN6.334e-3150.41Beta-amylase OS=Vigna unguiculata GN=BMY1 PE=2 SV=... [more]
AMYB_TRIRP6.334e-3149.59Beta-amylase OS=Trifolium repens GN=BMY1 PE=2 SV=1[more]
AMYB_MEDSA6.334e-3149.59Beta-amylase OS=Medicago sativa GN=BMY1 PE=2 SV=1[more]
AMYB_HORVU3.143e-3054.05Beta-amylase OS=Hordeum vulgare GN=BMY1 PE=1 SV=1[more]
AMYB_HORSP3.143e-3054.05Beta-amylase OS=Hordeum spontaneum GN=BMY1 PE=1 SV... [more]
AMYB_SOYBN7.742e-2947.93Beta-amylase OS=Glycine max GN=BMY1 PE=1 SV=3[more]
AMYB_IPOBA2.253e-2849.55Beta-amylase OS=Ipomoea batatas GN=BMY1 PE=1 SV=4[more]
AMYB_WHEAT6.554e-2851.35Beta-amylase OS=Triticum aestivum GN=BMY1 PE=2 SV=... [more]
AMYB_ARATH8.560e-2850.00Beta-amylase OS=Arabidopsis thaliana GN=BMY1 PE=2 ... [more]
AMYB_MAIZE1.046e-2548.65Beta-amylase OS=Zea mays GN=BMY1 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B06EF DevOvary1 Citrus clementina cDNA clone C32001B06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876170 ID=FC876170|Name=FC876170|organism=Citrus clementina|type=EST|length=649bp
GATTCCTTATTGGCCATTGCTCTTCATTTCCAAAGGAAAAAGAAAAATAT
AGTGCTATGGCCTTAACACTACGTTCTTCAACTTCTTTTATCAACTTAAA
TGACACCAAAACCATCAAAACACCCGACGAATTCTCATCACCCACTACTT
GTTTTGCCAAAATCAAGCCTTCACGCCGTCTCCGGGCTAAGAGTTCAATG
CAAGAAGCTCAGCTCTGTCGTGACAAACATTCAACAATGGGAGGAATTAT
TAGGAAGAGTGAGAAAAGAGAGATGGTTCATGAGCTCGCGAGTCCTCCTC
ACAATCATCATAGAAATAAGGTGCCTGTGTTTGTGATGTTGCCACTGGAC
ACGCTGTCAAACTCGGGGCACTTGAATAAGCCTAGAGCTATGAATGCTAG
TTTGATGGCCTTGAAAAGTGCCGGTGTTGAAGGAGTAATGGTTGATGCTT
GGTGGGGTTTGGTTGAGAAAGGAGGACCTCTCAATTATAACTGGGAAGGC
TATGCTGAGTTGATTCAAATGGTGAAAAAGCATGGCTTGAAGCTACAAGT
TGTTATGTCGTTTCATCAGTGTGGTGGAAATGTTGGAGACTCCTGCACTA
TTCCGCTACCTCCATGGGTGCTTGAAGAAATCAGCAAGAATCCTGACCT
back to top