FC876173

Overview
NameFC876173
Unique NameFC876173
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length713
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10302 contig Ccv1_Contig10302:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 6.065e-73
Identity = 129/184 (70.11%), Postives = 149/184 (80.98%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGPKPWPI+GNL HLGP PHQS A +A+T+GPLMYL++GF             QFLK HD+NFS+RPPNSGA+H+AYNYQD+VF PYGPRWRMLRKI SVHLFS KALDD+RHVRQ+E+  LTRALASAG +PV L Q LN+C  NAL RVMLG RVF DG+G  DP+A EFKSMVVE+MV+A
Sbjct:   34 PPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTNALARVMLGKRVFADGSGDVDPQAAEFKSMVVEMMVVA 217          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.225e-65
Identity = 114/184 (61.96%), Postives = 144/184 (78.26%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP PWPI+GNLPH+G  PH++++ +  T+GP+++LRLGF             QFLKIHD+NF++RPPNSGAKH+AYNYQD+VF PYG RWR+LRKISSVHLFS KAL+D++HVRQEE+  LTR L   GT+PVNL Q +N+CVVNALGR M+G R+FG     +D +ADEF+SMV E+M LA
Sbjct:   34 PPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNMCVVNALGREMIGRRLFG---ADADHKADEFRSMVTEMMALA 214          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 2.655e-44
Identity = 89/186 (47.85%), Postives = 126/186 (67.74%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP  WP++G LP LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL  +  VR++E+  +  A+A +G   +PV +++ L   + N LG+VML  RVF  G+ GS+  ++EFK MVVELM +A
Sbjct:   38 PPGPIGWPVLGALPLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVF--GSQGSE--SNEFKDMVVELMTVA 219          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.936e-43
Identity = 88/186 (47.31%), Postives = 125/186 (67.20%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP  WP++G L  LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL  +  VR++E+  +  A+A +G   +PV +++ L   + N LG+VML  RVF  G+ GS+  ++EFK MVVELM +A
Sbjct:   38 PPGPIGWPVLGALRLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMANMLGQVMLSKRVF--GSQGSE--SNEFKDMVVELMTVA 219          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.485e-42
Identity = 85/186 (45.70%), Postives = 123/186 (66.13%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP+ WP++G LP LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF PYGPRW++LRK+S++H+  GKAL+++ +VR  E+  + +++  AS   E + +A  L   + N +G+VML  RVF +         +EFK+MVVELM +A
Sbjct:   37 PPGPEGWPVIGALPLLGGMPHVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRPPNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDASHVGERIVVADMLTFAMANMIGQVMLSKRVFVE----KGKEVNEFKNMVVELMTVA 218          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 1.611e-41
Identity = 84/186 (45.16%), Postives = 120/186 (64.52%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTE--PVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP+ WP++G LP LG MPH S+A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL+++ +VR  E+  + ++++    E   V +A+ L   + N +G+VML  RVF D         +EFK MVVELM +A
Sbjct:   34 PPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMSDMSREGQRVVVAEMLTFAMANMIGQVMLSKRVFVD----KGVEVNEFKDMVVELMTIA 215          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A4_GENTR (Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.364e-40
Identity = 83/186 (44.62%), Postives = 119/186 (63.98%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP  WPI+G LP LG MPH + A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGP+W++LRK+S++H+  GKAL+++  VR+ E+  + +A+  +S   EPV +++ L   + N L +V+L  RVF         +++EFK MVVELM  A
Sbjct:   42 PPGPTGWPILGALPLLGNMPHVTFANMAKKYGSVMYLKVGSHGLAIASTPDAAKAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFAHYGPKWKLLRKLSNLHMLGGKALENWADVRKTELGYMLKAMFESSQNNEPVMISEMLTYAMANMLSQVILSRRVFNK----KGAKSNEFKDMVVELMTSA 223          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.572e-39
Identity = 82/186 (44.09%), Postives = 118/186 (63.44%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMVLA 713
            PPGP+ WP++G LP LG MPH S+A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AY  QD+VF  YGPRW++LRK+S++H+  GKAL+++ +VR  E+  + +++   S   E V +A+ L   + N +G+V+L  RVF +         +EFK MVVELM  A
Sbjct:   34 PPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMVVASTPDAAKAFLKTLDLNFSNRPPNAGATHLAYGAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDMSREGERVVVAEMLTFAMANMIGQVILSKRVFVN----KGVEVNEFKDMVVELMTTA 215          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.144e-37
Identity = 78/193 (40.41%), Postives = 115/193 (59.59%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTE----PVNLAQRLNLCVVNALGRVMLGFRVFG-----DGTGGSDPRADEFKSMVVELMVLA 713
            PPGP  WPI+G LP LG MPH S+A +A  +GP+MYL+LG               FLK HD+NFSNRP + G  ++AYN QD+VF  YGP+W++LRK+ S+H+   KAL+D+ HV+  E+  + + +    ++    PV + + L   + N +GR++L  R F      D +  +     EF+ MV+ELM +A
Sbjct:   39 PPGPTGWPIIGALPLLGTMPHVSLADMAVKYGPIMYLKLGSKGTVVASNPKAARAFLKTHDANFSNRPIDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVKVSEVGHMLKEMYEQSSKSVPVPVVVPEMLTYAMANMIGRIILSRRPFVITSKLDSSASASASVSEFQYMVMELMRMA 231          
BLAST of FC876173 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.349e-30
Identity = 65/185 (35.14%), Postives = 106/185 (57.30%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL---ASAGTEPVNLAQRLNLCVVNALGRVMLGFRVFGDGTGGSDPRADEFKSMVVELMV 707
            PPGP PWPI+GN   +    H+++  LA  +GP+++LR G               FLK HD  F++RPP S  K+  YN++DI F PYG  WR +RKI  + L + K ++ ++HVRQEE++ +  ++   + +G   VN+++ ++  + N L R+ L  + F D   G+D +   F  +VVE+ +
Sbjct:   43 PPGPYPWPIIGNFHQVRLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAISTSLANILWRI-LARKKFSDNDLGADGKG--FADLVVEVSI 224          
The following BLAST results are available for this feature:
BLAST of FC876173 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 121
Match NameE-valueIdentityDescription
F3PH_PETHY6.065e-7370.11Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
F3PH_ARATH1.225e-6561.96Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C75A5_EUSGR2.655e-4447.85Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A7_EUSGR2.936e-4347.31Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A2_SOLME2.485e-4245.70Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C75A1_PETHY1.611e-4145.16Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C75A4_GENTR1.364e-4044.62Flavonoid 3',5'-hydroxylase OS=Gentiana triflora G... [more]
C75A3_PETHY2.572e-3944.09Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C75A6_CAMME3.144e-3740.41Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C75A1_PINTA6.349e-3035.14Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B09EF DevOvary1 Citrus clementina cDNA clone C32001B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876173 ID=FC876173|Name=FC876173|organism=Citrus clementina|type=EST|length=713bp
GGCGACTACTCGTACCATTTCTACACTTTCTCTGGGAAACGAAACAAAGA
GCAATGTCTACTTTACCACTACTGATACTGTACACATCACTTTTGGCAAT
TGTCATTTCTTTCCTTTTTAGCCTCCTCCGGAACAGACGCAGACACTCCT
CCCACCGTCTGCCTCCCGGTCCGAAACCCTGGCCAATAGTCGGAAACCTC
CCTCACTTGGGCCCTATGCCCCACCAATCCATAGCGGGTCTGGCCCGAAC
CCACGGCCCCCTCATGTACCTCCGGTTAGGCTTCGTTGACGTCGTCGTGG
CCGCTTCCGCTTCCGTGGCGGCCCAATTCCTGAAGATCCATGATTCCAAC
TTCTCCAACCGCCCTCCCAACTCCGGCGCCAAGCACATCGCTTACAACTA
TCAGGACATCGTTTTCCGGCCGTACGGCCCCCGCTGGCGGATGCTGAGGA
AGATCAGCTCCGTTCATCTTTTCTCCGGCAAGGCCTTGGATGACTACAGG
CACGTTCGCCAGGAAGAGATGGCGGTGCTCACGCGCGCGTTGGCGAGTGC
AGGAACGGAGCCGGTGAACTTAGCTCAACGGTTGAACTTGTGCGTTGTGA
ATGCCCTAGGGCGGGTGATGCTAGGCTTCAGAGTGTTCGGCGACGGTACC
GGAGGGAGCGACCCGAGGGCTGACGAGTTCAAATCAATGGTTGTGGAGCT
GATGGTGCTGGCG
back to top