FC876174

Overview
NameFC876174
Unique NameFC876174
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9339 contig Ccv1_Contig9339:1..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 419.468 bits (1077), Expect = 8.902e-117
Identity = 204/208 (98.08%), Postives = 206/208 (99.04%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 1.983e-116
Identity = 204/208 (98.08%), Postives = 206/208 (99.04%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNP+KVPFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 3.383e-116
Identity = 203/208 (97.60%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 5.770e-116
Identity = 203/208 (97.60%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 7.536e-116
Identity = 202/208 (97.12%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 9.842e-116
Identity = 203/208 (97.60%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+ FVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 1.679e-115
Identity = 202/208 (97.12%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 414.461 bits (1064), Expect = 2.864e-115
Identity = 201/208 (96.63%), Postives = 205/208 (98.56%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 8.332e-115
Identity = 200/208 (96.15%), Postives = 204/208 (98.08%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLKKVGYNP+K+PFVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNL 208          
BLAST of FC876174 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.856e-114
Identity = 201/208 (96.63%), Postives = 202/208 (97.12%), Query Frame = 3
Query:   84 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEVAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPTSGFEGDNMIERSTNL 707
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKE AEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+ FVP SGFEGDNMIERSTNL
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNL 208          
The following BLAST results are available for this feature:
BLAST of FC876174 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ8.902e-11798.08Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_WHEAT1.983e-11698.08Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MANES3.383e-11697.60Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_TOBAC5.770e-11697.60Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH7.536e-11697.12Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MAIZE9.842e-11697.60Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_SOLLC1.679e-11597.12Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_SOYBN2.864e-11596.63Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_VICFA8.332e-11596.15Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A1_DAUCA1.856e-11496.63Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001B11EF DevOvary1 Citrus clementina cDNA clone C32001B11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876174 ID=FC876174|Name=FC876174|organism=Citrus clementina|type=EST|length=707bp
GACTCTTTGCCCTCCCTCTTTTCTTGCTTGCTCTGCGGCTAGGTTTCAAT
TGTCTCTTCGAAGTTTCAGTTAATTTAACAGCCATGGGTAAGGAGAAGAC
TCACATCAACATTGTGGTGATTGGCCATGTCGACTCTGGAAAGTCGACCA
CCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATC
GAGAGGTTCGAGAAGGAAGTTGCTGAGATGAACAAGAGGTCATTCAAGTA
CGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCA
TTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTC
ATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTAC
CTCACAGGCTGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTT
TTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTT
GCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGA
CGCCACCACCCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGG
AGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCA
TTCGTGCCCACCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTAC
CAACCTT
back to top