FC876211

Overview
NameFC876211
Unique NameFC876211
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length727
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig108 contig Ccv1_Contig108:371..1098. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 7.082e-109
Identity = 189/215 (87.91%), Postives = 203/215 (94.42%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MATSTMALSSS F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 3.515e-108
Identity = 187/215 (86.98%), Postives = 203/215 (94.42%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA STMALSS SF GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAEL++++
Sbjct:    1 MAASTMALSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 3.515e-108
Identity = 185/214 (86.45%), Postives = 201/214 (93.93%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAEL++++
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE 214          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 3.886e-107
Identity = 185/213 (86.85%), Postives = 199/213 (93.43%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TMALSS SF G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DPEAFAEL++++
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE 213          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 387.497 bits (994), Expect = 3.886e-107
Identity = 183/213 (85.92%), Postives = 200/213 (93.90%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TMALSS SF G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAEL++++
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE 213          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 6.629e-107
Identity = 183/214 (85.51%), Postives = 200/214 (93.46%), Query Frame = 3
Query:   54 MATSTMALSSSFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA ST ALSS F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DPEAFAEL++++
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKE 214          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 1.131e-106
Identity = 184/214 (85.98%), Postives = 202/214 (94.39%), Query Frame = 3
Query:   54 MATSTMALSSS-FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLR 686
            MA +TMALSSS F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DPEAFAEL+++
Sbjct:    1 MAAATMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVK 214          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.477e-106
Identity = 185/215 (86.05%), Postives = 200/215 (93.02%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            M  STMALSS SF G AV L+PS +E++  G+  MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MTASTMALSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 7.329e-106
Identity = 185/215 (86.05%), Postives = 198/215 (92.09%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSK--SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA+STMALSS S  GKAV L P+ +E+   GRI+MRKT  K  +V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 215          
BLAST of FC876211 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.572e-106
Identity = 184/215 (85.58%), Postives = 200/215 (93.02%), Query Frame = 3
Query:   54 MATSTMALSS-SFVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELRLRK 689
            MA +TMALSS SF GKAV  +PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDPEAFAEL++++
Sbjct:    1 MAAATMALSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKE 215          
The following BLAST results are available for this feature:
BLAST of FC876211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 76
Match NameE-valueIdentityDescription
CB2G_SOLLC7.082e-10987.91Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC3.515e-10886.98Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC3.515e-10886.45Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2B_SOLLC3.886e-10786.85Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB22_TOBAC3.886e-10785.92Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB25_NICPL6.629e-10785.51Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB25_TOBAC1.131e-10685.98Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB27_TOBAC1.477e-10686.05Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB2A_SPIOL7.329e-10686.05Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB25_PETSP9.572e-10685.58Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G04EF DevOvary1 Citrus clementina cDNA clone C32001G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876211 ID=FC876211|Name=FC876211|organism=Citrus clementina|type=EST|length=727bp
GACCTCTCAACACTCGAACACTAGAGCTCACCAACAACTCTGATCATTGC
AAAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGC
TGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCCGCATCT
CCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGCAGCCCGTGGTAC
GGCCCGGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAG
CTACTTGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGC
TTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAAGTCATC
CACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCT
CTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCGG
GAGCTCAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGC
TTGATCCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTCTT
GATGGGAGCTGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAG
TGACCGACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCT
GATGACCCGGAGGCTTTTGCTGAGCTCAGGTTAAGGAAATCAAGAATGGA
AGGTTGGCTATGTTCTCCATGTTTGGT
back to top