FC876212

Overview
NameFC876212
Unique NameFC876212
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10313 contig Ccv1_Contig10313:1..671. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: RHM3_ARATH (Probable rhamnose biosynthetic enzyme 3 OS=Arabidopsis thaliana GN=RHM3 PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 8.083e-93
Identity = 167/179 (93.30%), Postives = 173/179 (96.65%), Query Frame = 2
Query:  134 MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            MATY PKNILITGAAGFIASHV NRL+R+YP+YKIVVLDKLDYCSNLKNL PSK+S NFKFV+GDIASADLVN+LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct:    1 MATYKPKNILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFVKGDIASADLVNYLLITEEIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDASVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 179          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: RHM1_ARATH (Probable rhamnose biosynthetic enzyme 1 OS=Arabidopsis thaliana GN=RHM1 PE=2 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.056e-92
Identity = 168/179 (93.85%), Postives = 173/179 (96.65%), Query Frame = 2
Query:  134 MATYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            MA+YTPKNILITGAAGFIASHV NRLIR+YP+YKIVVLDKLDYCSNLKNL PSK S NFKFV+GDIASADLVN LLITE IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDA+VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct:    1 MASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFVKGDIASADLVNHLLITEGIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDALVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 179          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: RHM2_ARATH (Probable rhamnose biosynthetic enzyme 2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.290e-90
Identity = 164/177 (92.66%), Postives = 170/177 (96.05%), Query Frame = 2
Query:  140 TYTPKNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            TY PKNILITGAAGFIASHV NRLIRNYP+YKIVVLDKLDYCS+LKNL PS +S NFKFV+GDIAS DLVN+LLITE+IDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDA VGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL
Sbjct:    5 TYKPKNILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFVKGDIASDDLVNYLLITENIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAAVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 181          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: TGDS_MOUSE (dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 2.637e-43
Identity = 89/171 (52.05%), Postives = 115/171 (67.25%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSY 664
            K +L+TG AGFIASHV   L+ +YP+Y IV LDKLDYC++LKNL P     N+KF++GDI  +  V  L   E ID ++HFAAQTHVD SF  +FEFT  N+YGTHVL+ A    G + +FI+VSTDEVYG + +       E+S   PTNPY+++KA AE  V +Y   Y
Sbjct:   18 KRVLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCASLKNLEPVSNKQNYKFIQGDICDSHFVKLLFEVEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVNAAYEAG-VEKFIYVSTDEVYGGSLDQEF---DESSPKQPTNPYASSKAAAECFVQSYWERY 184          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: TGDS_HUMAN (dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.494e-42
Identity = 86/171 (50.29%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSY 664
            K +L+TG AGFIASH+   L+ +YP Y I+ LDKLDYC++LKNL       N+KF++GDI  +  V  L  TE ID ++HFAAQTHVD SF  +FEFT  N+YGTHVL+ A     ++ +FI+VSTDEVYG + +       E+S   PTNPY+++KA AE  V +Y   Y
Sbjct:   18 KRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAH-EARVEKFIYVSTDEVYGGSLDKEF---DESSPKQPTNPYASSKAAAECFVQSYWEQY 184          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: TGDS_BOVIN (dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 6.494e-42
Identity = 86/171 (50.29%), Postives = 114/171 (66.67%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSY 664
            K +L+TG AGFIASH+   L+ +YP Y I+ LDKLDYC++LKNL       N+KF++GDI  +  V  L  TE ID ++HFAAQTHVD SF  +FEFT  N+YGTHVL+ A     ++ +FI+VSTDEVYG + +       E+S   PTNPY+++KA AE  V +Y   Y
Sbjct:   18 KRVLVTGGAGFIASHMIVSLVEDYPNYMIINLDKLDYCASLKNLETISNKQNYKFIQGDICDSHFVKLLFETEKIDIVLHFAAQTHVDLSFVRAFEFTYVNVYGTHVLVSAAH-EARVEKFIYVSTDEVYGGSLDKEF---DESSPKQPTNPYASSKAAAECFVQSYWEQY 184          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: TGDS_DICDI (dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.209e-41
Identity = 90/181 (49.72%), Postives = 119/181 (65.75%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYG--------ETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            + ILITG AGFI SH+   L + +   KI+VLDKLDYCSN+ NL       NFKF +G+I  ++L+  +   E ID ++H AA THVDNSF  S +FT+NNI GTH LLE CK   ++++FI+VSTDEVYG        + +      ++E S L PTNPYSA+KAGAE LV +Y +S+ L
Sbjct:   10 QKILITGGAGFIGSHLAIYLTKKFKNSKIIVLDKLDYCSNINNLGCVLKELNFKFYKGNILDSELLENIFEKEKIDIVIHLAAYTHVDNSFKQSIKFTENNILGTHYLLETCK-NYKLKKFIYVSTDEVYGSGLIEDNDDNNNSINQSSNEKSILNPTNPYSASKAGAEHLVQSYYKSFKL 189          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: TGDS_MIMIV (Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.037e-39
Identity = 84/173 (48.55%), Postives = 114/173 (65.90%), Query Frame = 2
Query:  152 KNILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            KNIL+TG  GFI S+  N +   Y    I V D  DYC++++N+   + ++  K ++GDI + DL+   L    IDTI+HFAA +HVDNSF NS  FT+ N++GTHVLLE  ++ G+++ F H+STDEVYGE D      + E S L PTNPY+ATKAGAE +V +Y  SY L
Sbjct:    2 KNILVTGGLGFIGSNFVNHISSKYDNVNIYVYDIGDYCASVENV---EWNNRTKLIKGDIRNFDLIMHTLTEHEIDTIVHFAAHSHVDNSFKNSLAFTETNVFGTHVLLECSRMYGKLKLFFHMSTDEVYGEIDTTDT--SREVSLLCPTNPYAATKAGAEHIVKSYFLSYKL 169          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: ACBB_ACTS5 (dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain 50/110) GN=acbB PE=3 SV=2)

HSP 1 Score: 137.502 bits (345), Expect = 6.092e-32
Identity = 78/176 (44.32%), Postives = 105/176 (59.66%), Query Frame = 2
Query:  158 ILITGAAGFIASHVCNRLIRN-----YPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFVRGDIASADLVNFLLITESIDTIMHFAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKVTGQIRRFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSYGL 670
            IL+TG AGFI SH    LI        P  ++ V+DKL Y  NL+NL  + A   F FVRGDI    L+  L+     DT+ HFAA+THVD S   S  F  +N+ GT VLL+A  +   I RF+HVSTDEVYG  D  +    H    L P +PY+A+KAG+++L +AY +++G+
Sbjct:    3 ILVTGGAGFIGSHFVTSLISGDIATPQPVTQVTVVDKLGYGGNLRNLAEASADPRFSFVRGDICDEGLIEGLMARH--DTVAHFAAETHVDRSVVASGPFVASNLVGTQVLLDAA-LRHHIGRFLHVSTDEVYGSIDTGSWAEGH---PLAPNSPYAASKAGSDLLALAYHQTHGM 172          
BLAST of FC876212 vs. ExPASy Swiss-Prot
Match: YHEB_SCHPO (Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe GN=SPBPB2B2.11 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.459e-27
Identity = 75/182 (41.21%), Postives = 107/182 (58.79%), Query Frame = 2
Query:  161 LITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKA--SSNFKFVRGDIAS--ADLVNFLLITESIDTIMH---FAAQTHVDNSFGNSFEFTKNNIYGTHVLLEACKV----TGQIR---RFIHVSTDEVYGETDEDAVVGNHEASQLLPTNPYSATKAGAEMLVMAYGRSY 664
            LITG AGFI S+  +  +  YP++    +DKL Y SN   +  SK     NF+F+  D+A+    L  F++    I+ I H   FAA++ VD SF +   FTKNNI  T  LLE  ++      ++R    F+HVSTDEVYGE DE+A V   E S+L PT+PY+A+KA  ++++ +Y  SY
Sbjct:   13 LITGGAGFIGSNFLDYAVDKYPDFHFTCIDKLSYVSNYTTVFLSKVLNQPNFRFLEMDLATNYKFLYQFMVEDSEINKITHIINFAAESSVDRSFIDPLYFTKNNILSTQNLLECVRILLGKKEELRNRLNFVHVSTDEVYGEQDENASV--DEKSKLNPTSPYAASKAAVDLIIQSYRYSY 192          
The following BLAST results are available for this feature:
BLAST of FC876212 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
RHM3_ARATH8.083e-9393.30Probable rhamnose biosynthetic enzyme 3 OS=Arabido... [more]
RHM1_ARATH1.056e-9293.85Probable rhamnose biosynthetic enzyme 1 OS=Arabido... [more]
RHM2_ARATH1.290e-9092.66Probable rhamnose biosynthetic enzyme 2 OS=Arabido... [more]
TGDS_MOUSE2.637e-4352.05dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=... [more]
TGDS_HUMAN6.494e-4250.29dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=... [more]
TGDS_BOVIN6.494e-4250.29dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TG... [more]
TGDS_DICDI4.209e-4149.72dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium di... [more]
TGDS_MIMIV1.037e-3948.55Putative dTDP-D-glucose 4,6-dehydratase OS=Acantha... [more]
ACBB_ACTS56.092e-3244.32dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (... [more]
YHEB_SCHPO3.459e-2741.21Uncharacterized protein PB2B2.11 OS=Schizosaccharo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G06EF DevOvary1 Citrus clementina cDNA clone C32001G06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876212 ID=FC876212|Name=FC876212|organism=Citrus clementina|type=EST|length=670bp
GCTCACTCTTCAAAAGATCACCGCGGTTTCTTCTCAGTTTCCATTTTCAC
ACAGTTTCTCTCTCTAGATTCGCGTTTTGGCATTTGGGTTTGACTCGTCT
TCGTTGATCTGATCGTCTTTAAGTTGATTTGCAATGGCTACGTATACCCC
GAAGAACATCCTCATCACTGGGGCTGCTGGGTTCATTGCTTCCCATGTAT
GCAACCGGCTGATTCGTAACTATCCCGAGTACAAAATTGTTGTGCTTGAC
AAGCTTGATTATTGTTCGAATCTGAAAAACCTAATACCCTCCAAAGCATC
CTCCAACTTTAAGTTTGTTAGGGGGGACATTGCCAGTGCTGACCTTGTCA
ACTTTCTTCTCATCACTGAGTCCATTGACACTATTATGCACTTTGCTGCG
CAAACTCATGTGGACAACTCTTTTGGAAATAGTTTTGAGTTTACCAAGAA
CAATATCTATGGTACTCATGTCCTCCTTGAAGCCTGCAAAGTGACTGGGC
AGATCCGGAGGTTCATCCATGTCAGCACAGATGAGGTCTATGGGGAGACT
GACGAGGATGCTGTTGTGGGTAACCATGAAGCTTCCCAACTCCTGCCAAC
AAATCCTTATTCTGCAACTAAAGCTGGAGCAGAAATGCTTGTTATGGCTT
ATGGTAGGTCATATGGGCTA
back to top