FC876215

Overview
NameFC876215
Unique NameFC876215
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10294 contig Ccv1_Contig10294:7..702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.155e-59
Identity = 119/211 (56.40%), Postives = 144/211 (68.25%), Query Frame = 3
Query:   96 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC--DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            GSA  CG    G +CPGG CCS+FGWCG T D+C   +GCQS C+           G+ GD G L  +I+RE F+ +L +RND  CPAR FYTYDAFI AAK+FPAF  +G++  RKRE+AAF AQT HETTG  GW  AP G Y WGYC+NRE+  A  DYC  DPNYPC  GK Y+GRGP+QLTWN +Y +CG  +  G D ++NPDLL
Sbjct:   19 GSAEQCGRQAGGALCPGGLCCSQFGWCGNTDDYCKKENGCQSQCS-----------GSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWA-APDGPYTWGYCYNRELNPA--DYCQWDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAI--GVDLLNNPDLL 213          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.815e-59
Identity = 111/207 (53.62%), Postives = 140/207 (67.63%), Query Frame = 3
Query:   96 GSAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            GSA  CG    G VCPGG CCS+FGWCG T D+C  GCQS C+                 G++G++I+R MF D+L++RN+  CP + FYTYDAFI AAKAFP FG +G+ T RKREIAAF AQT HETTGGW  AP G YAWGYC+ RE G+  + YC P+  +PC    KYYGRGPIQ+++N +Y + G+ +  G D V+NPDL+
Sbjct:   18 GSAEQCGGQAGGRVCPGGACCSKFGWCGNTADYCGSGCQSQCSST---------------GDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGPYAWGYCYLREQGSPGA-YCVPSAQWPCAAGRKYYGRGPIQISYNYNYGQAGKAI--GVDLVNNPDLV 206          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 1.070e-58
Identity = 114/201 (56.72%), Postives = 134/201 (66.67%), Query Frame = 3
Query:   96 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGE-----CDPDDGTAGDG--GELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDP--NYPC-RGKYY-GRGPIQLTWNLHYLRCGEGL 656
            GSA  CG      +CPGG CCS +GWCG T+D+C  GCQS C+    G+     CD  D   GDG  G L  II +  F+ LL++RND RCPA  FYTY+AFI AAK FP FGN+G++ MRKREIAAF  QT HETTGGWPDAP G YAWGYC+ +E+      YCDP  NY C  GK Y GRGPIQL+WN +Y  CG+ L
Sbjct:   20 GSAEQCGRQAGDALCPGGLCCSSYGWCGTTVDYCGIGCQSQCDGGGGGDGGDDGCDGGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWPDAPCGPYAWGYCYLKEINC--QPYCDPSSNYQCVAGKQYCGRGPIQLSWNYNYGLCGDDL 218          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.065e-58
Identity = 119/210 (56.67%), Postives = 141/210 (67.14%), Query Frame = 3
Query:   96 GSAGNCG---SGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            GSA  CG    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+WN +Y +CG  +  G D ++NPDLL
Sbjct:   20 GSAEQCGRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAI--GVDLLNNPDLL 216          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 3.441e-57
Identity = 107/207 (51.69%), Postives = 134/207 (64.73%), Query Frame = 3
Query:   93 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            GGS G  CG    G +CPGG CCS+FGWCG T D+C  GCQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++WN +Y +CG  +  G D ++ PDL+
Sbjct:   23 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGPGCQSQCG-----------GPSPAPTDLSALISRSTFDQMLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSTYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAI--GVDLLNKPDLV 216          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 5.870e-57
Identity = 104/204 (50.98%), Postives = 134/204 (65.69%), Query Frame = 3
Query:   99 SAGNCGS---GVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCRG--KYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            SA  CG+   G +CPGG CCS+FGWCG T ++C DGCQS C+           G++G GG L  +IS + F ++L++RND  C  + FYTYDAF+ AAKAFP F N G+   +KREIAAF  QT HETTGGWP AP G YAWGYCF RE   ++       +PC    +YYGRGPIQ++WN +Y +CG  +  G D ++NPDL+
Sbjct:   19 SAEQCGTQAGGALCPGGLCCSKFGWCGSTSEYCGDGCQSQCS-----------GSSG-GGTLSSLISGDTFNNMLKHRNDNACQGKPFYTYDAFLSAAKAFPNFANKGDTATKKREIAAFLGQTSHETTGGWPTAPDGPYAWGYCFLREQNPSTYCQASSEFPCASGKQYYGRGPIQISWNYNYGQCGRAI--GVDLLNNPDLV 208          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 5.870e-57
Identity = 115/204 (56.37%), Postives = 137/204 (67.16%), Query Frame = 3
Query:  105 GNCGSGVVCPGGECCSRFGWCGLTIDHCC-DGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTG--GWPDAPGGEYAWGYCFNREVGAASSDYC--DPNYPCR-GK-YYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            G    G +CPGG CCS+FGWCG T D+C   GCQS C+           G A   G L  +ISRE F  +L +RND  CPAR FYTYDAFI AA++FPAF  +G++  RKREIAAF AQT HETTG  GW  AP G YAWGYC+NRE+   SS YC  DPNYPC  GK Y+GRGP+QL+WN +Y +CG  +  G D ++NPDLL
Sbjct:    4 GRQAGGALCPGGLCCSQFGWCGSTADYCTVPGCQSQCS---------GSGPAPGPGGLTNLISRETFNQMLLHRNDGACPARGFYTYDAFIAAARSFPAFATTGDQATRKREIAAFLAQTSHETTGGAGWA-APDGPYAWGYCYNRELNPPSS-YCASDPNYPCAPGKQYFGRGPMQLSWNYNYGQCGRAI--GVDLLNNPDLL 194          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 219.164 bits (557), Expect = 1.708e-56
Identity = 108/207 (52.17%), Postives = 135/207 (65.22%), Query Frame = 3
Query:   99 SAGNCG---SGVVCPGGECCSRFGWCGLTIDHCCD-GCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            SA  CG    G +CP G CCS FGWCG T  +C   GCQS        +C P     G  G+L  IIS   F+D+L++RND  CPAR FYTY+AFI AAK+FP FG +G+   RK+E+AAFF QT HETTGGW  AP G Y+WGYCF +E   A SDYC+P+  +PC    +YYGRGP+QL+WN +Y  CG  +  G D ++NPDL+
Sbjct:   32 SAEQCGRQAGGALCPNGLCCSEFGWCGNTEPYCKQPGCQS--------QCTPGGTPPGPTGDLSGIISSSQFDDMLKHRNDAACPARGFYTYNAFITAAKSFPGFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPA-SDYCEPSATWPCASGKRYYGRGPMQLSWNYNYGLCGRAI--GVDLLNNPDLV 227          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.913e-56
Identity = 106/207 (51.21%), Postives = 133/207 (64.25%), Query Frame = 3
Query:   93 GGSAGN-CG---SGVVCPGGECCSRFGWCGLTIDHCCDGCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPNYPCR--GKYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            GGS G  CG    G +CPGG CCS+FGWCG T D+C   CQS C            G +    +L  +ISR  F+ +L++RND  CPA+ FYTYDAFI AAKA+P+FGN+G+   RKREIAAF  QT HETTGGW  AP G YAWGYCF RE   ++     P +PC    +YYGRGPIQ++WN +Y +CG  +  G D ++ PDL+
Sbjct:   22 GGSYGEQCGRQAGGALCPGGNCCSQFGWCGSTTDYCGKDCQSQCG-----------GPSPAPTDLSALISRSTFDQVLKHRNDGACPAKGFYTYDAFIAAAKAYPSFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPSAYCSATPQFPCAPGQQYYGRGPIQISWNYNYGQCGRAI--GVDLLNKPDLV 215          
BLAST of FC876215 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 2.913e-56
Identity = 108/202 (53.47%), Postives = 132/202 (65.35%), Query Frame = 3
Query:  105 GNCGSGVVCPGGECCSRFGWCGLTIDHCCD-GCQSNCNQVVCGECDPDDGTAGDGGELGKIISREMFEDLLEYRNDKRCPARCFYTYDAFIEAAKAFPAFGNSGNETMRKREIAAFFAQTCHETTGGWPDAPGGEYAWGYCFNREVGAASSDYCDPN--YPCRG--KYYGRGPIQLTWNLHYLRCGEGLGRGEDFVDNPDLL 695
            G    G +CP G CCS FGWCG T  +C   GCQS C     G   P     G  G+L  IISR  F+D+L++RND  CPAR FYTYDAFI AAK+FP FG +G+   RK+EIAAFF QT HETTGGW  AP G Y+WGYCF +E    SS+YC P+  +PC     YYGRGP+QL+WN +Y +CG  +  G D ++NPDL+
Sbjct:   24 GRQAGGALCPNGLCCSEFGWCGDTEAYCKQPGCQSQC-----GGTPP-----GPTGDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQN-PSSNYCSPSAEWPCASGKSYYGRGPMQLSWNYNYGQCGRAI--GSDLLNNPDLV 212          
The following BLAST results are available for this feature:
BLAST of FC876215 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
CHI1_THECC2.155e-5956.40Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIB_VITVI2.815e-5953.62Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI6_POPTR1.070e-5856.72Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI1_GOSHI4.065e-5856.67Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHIT_PHAVU3.441e-5751.69Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI2_PEA5.870e-5750.98Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHI2_GOSHI5.870e-5756.37Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHIB_ARATH1.708e-5652.17Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI5_PHAVU2.913e-5651.21Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_BRANA2.913e-5653.47Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G11EF DevOvary1 Citrus clementina cDNA clone C32001G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876215 ID=FC876215|Name=FC876215|organism=Citrus clementina|type=EST|length=696bp
AAGCAGAGGATAATTGATATCATAACTGTTGCTTTCAAATGAGGCTTATT
GCGTCCTTACTAATTTTCTCTCTGGTTTTATCTTTTGTACTAGGAGGCTC
AGCAGGGAACTGTGGAAGCGGCGTTGTGTGCCCAGGAGGGGAGTGTTGTA
GTCGATTTGGTTGGTGTGGCCTAACAATAGACCACTGTTGTGACGGCTGC
CAAAGTAACTGTAATCAGGTTGTTTGCGGTGAATGTGATCCCGACGACGG
GACGGCTGGTGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGT
TTGAAGACTTGCTTGAGTATAGAAATGATAAACGATGCCCTGCCAGATGC
TTCTACACTTATGATGCTTTTATAGAGGCAGCCAAAGCTTTTCCAGCCTT
TGGTAACTCTGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTT
TTGCCCAAACTTGCCATGAAACTACTGGGGGATGGCCCGATGCACCTGGT
GGCGAATATGCTTGGGGATATTGCTTTAATAGGGAAGTTGGCGCTGCGTC
GTCCGACTACTGTGATCCTAACTATCCATGTCGAGGGAAGTACTATGGTC
GAGGTCCAATTCAACTCACTTGGAATTTACATTACTTACGGTGCGGAGAA
GGCCTAGGGCGAGGAGAGGACTTTGTTGACAATCCAGACCTTCTTG
back to top