FC876217

Overview
NameFC876217
Unique NameFC876217
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length640
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10254 contig Ccv1_Contig10254:50..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_CATRO (Adenosylhomocysteinase OS=Catharanthus roseus GN=SAHH PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 9.427e-88
Identity = 156/187 (83.42%), Postives = 167/187 (89.30%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLKA 640
            MAL V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQ+H              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K G LPDP+STD AEFQIVLTIIRDGLK+
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKS 187          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MEDSA (Adenosylhomocysteinase OS=Medicago sativa GN=SAHH PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.582e-87
Identity = 153/186 (82.26%), Postives = 165/186 (88.71%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+ + SGRE+KVKD+SQADFGRLEIELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWC+E+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE++EKTG+LPDP+STD AE QIVLTIIRDGLK
Sbjct:    1 MALLVETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH1_ARATH (Adenosylhomocysteinase 1 OS=Arabidopsis thaliana GN=SAHH1 PE=1 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 4.679e-87
Identity = 152/186 (81.72%), Postives = 167/186 (89.78%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEI+EKTG++PDP STD  EFQIVL+II++GL+
Sbjct:    1 MALLVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQ 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PETCR (Adenosylhomocysteinase OS=Petroselinum crispum GN=SAHH PE=2 SV=2)

HSP 1 Score: 318.161 bits (814), Expect = 2.322e-86
Identity = 152/187 (81.28%), Postives = 166/187 (88.77%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLKA 640
            MALSV+K+A+GRE+KVKD+S ADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMTIQT VLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y+K+G +PDPASTD AEFQIVL+IIRDGLK+
Sbjct:    1 MALSVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRDGLKS 187          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_LUPLU (Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 3.033e-86
Identity = 153/186 (82.26%), Postives = 165/186 (88.71%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMA R+EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEEIYEK+G+ PDP STD AEF+IVL+II++GLK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_MESCR (Adenosylhomocysteinase OS=Mesembryanthemum crystallinum GN=SAHH PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 8.824e-86
Identity = 152/186 (81.72%), Postives = 162/186 (87.10%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL+V+K++SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWG GGGPDLIVDDGGDATLLIHEGVKAEE YEK G +PDP STD  EFQ+VL +IRD LK
Sbjct:    1 MALAVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDSLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_TOBAC (Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAHH PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.152e-85
Identity = 152/186 (81.72%), Postives = 162/186 (87.10%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STD AEFQ+VLTII++ LK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_PHASS (Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.152e-85
Identity = 153/185 (82.70%), Postives = 162/185 (87.57%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGL 634
            MAL V+K+ SGRE+KVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ L+WG GGGPDLIVDDGGDATLLIHEGVKAEE YEK GK+PDPASTD AEFQIVL +IRD L
Sbjct:    1 MALLVEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDSL 185          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_NICSY (Adenosylhomocysteinase OS=Nicotiana sylvestris GN=SAHH PE=2 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 1.152e-85
Identity = 152/186 (81.72%), Postives = 162/186 (87.10%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MAL V+K+ SGRE+KVKD+SQADFGRLEIELAEVEMPGLMACR EFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDH              WKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP STD AEFQ+VLTII++ LK
Sbjct:    1 MALLVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLK 186          
BLAST of FC876217 vs. ExPASy Swiss-Prot
Match: SAHH_WHEAT (Adenosylhomocysteinase OS=Triticum aestivum GN=SAHH PE=2 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 7.470e-85
Identity = 150/186 (80.65%), Postives = 164/186 (88.17%), Query Frame = 2
Query:   80 MALSVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHXXXXXXXXXXXXXXWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDYAEFQIVLTIIRDGLK 637
            MALSV+K++SGRE+KVKDL QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+I+GSLHMTIQTAVLIETLTALGAEVRWCSCNIFS+QDH              WKGETL+EYWWCTE+ LDWG GGGPDLIVDDGGDATLLIHEGVKAEE +EK+GK+PDP STD  EF+IVLTIIRDGLK
Sbjct:    1 MALSVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLK 186          
The following BLAST results are available for this feature:
BLAST of FC876217 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 235
Match NameE-valueIdentityDescription
SAHH_CATRO9.427e-8883.42Adenosylhomocysteinase OS=Catharanthus roseus GN=S... [more]
SAHH_MEDSA3.582e-8782.26Adenosylhomocysteinase OS=Medicago sativa GN=SAHH ... [more]
SAHH1_ARATH4.679e-8781.72Adenosylhomocysteinase 1 OS=Arabidopsis thaliana G... [more]
SAHH_PETCR2.322e-8681.28Adenosylhomocysteinase OS=Petroselinum crispum GN=... [more]
SAHH_LUPLU3.033e-8682.26Adenosylhomocysteinase OS=Lupinus luteus GN=SAHH P... [more]
SAHH_MESCR8.824e-8681.72Adenosylhomocysteinase OS=Mesembryanthemum crystal... [more]
SAHH_TOBAC1.152e-8581.72Adenosylhomocysteinase OS=Nicotiana tabacum GN=SAH... [more]
SAHH_PHASS1.152e-8582.70Adenosylhomocysteinase OS=Phalaenopsis sp. GN=SAHH... [more]
SAHH_NICSY1.152e-8581.72Adenosylhomocysteinase OS=Nicotiana sylvestris GN=... [more]
SAHH_WHEAT7.470e-8580.65Adenosylhomocysteinase OS=Triticum aestivum GN=SAH... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H01EF DevOvary1 Citrus clementina cDNA clone C32001H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876217 ID=FC876217|Name=FC876217|organism=Citrus clementina|type=EST|length=640bp
GTGGTCGGGTTCACAAAGAGAGAGTATAGTGACCTCTCTTCCTTCTTCCT
TTTAGATCTATCAATTCTATTAATAAGCCATGGCTTTGTCCGTCCAGAAA
TCCGCTAGCGGTCGTGAATTCAAGGTGAAGGATCTGTCCCAGGCTGACTT
CGGCCGCCTCGAAATCGAGTTGGCCGAAGTCGAAATGCCGGGGCTCATGG
CTTGCCGCGCCGAGTTCGGCCCTTCACAGCCCTTCAAAGGAGCCAAGATC
ACCGGTTCACTCCACATGACCATCCAGACCGCCGTCCTCATCGAGACCCT
CACCGCTCTCGGCGCCGAAGTCCGCTGGTGCTCCTGCAACATCTTCTCAA
CCCAAGACCACGCGGCCGCCGCCATCGCACGTGACTCCGCCTCCGTCTTT
GCCTGGAAGGGTGAGACCCTCCAGGAGTACTGGTGGTGCACGGAGAAAGC
CCTGGACTGGGGTCCCGGCGGCGGCCCAGATCTCATCGTCGATGACGGTG
GTGACGCCACGTTGTTGATCCACGAGGGAGTCAAAGCTGAGGAGATCTAC
GAGAAGACCGGGAAGTTGCCCGACCCGGCCTCCACCGACTACGCCGAGTT
TCAGATTGTTTTGACTATCATTAGAGATGGGTTGAAGGCC
back to top