FC876218

Overview
NameFC876218
Unique NameFC876218
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 367.466 bits (942), Expect = 4.149e-111
Identity = 181/181 (100.00%), Postives = 181/181 (100.00%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 55.8398 bits (133), Expect = 4.149e-111
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPADTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 2.715e-104
Identity = 168/179 (93.85%), Postives = 173/179 (96.65%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+EIR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 183          

HSP 2 Score: 55.8398 bits (133), Expect = 2.715e-104
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:  184 RGARVLVVCSEITAVTFRGPADTHLDS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 7.868e-104
Identity = 168/179 (93.85%), Postives = 174/179 (97.21%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+EIR AQRADGPATVLAIGTATPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 183          

HSP 2 Score: 54.299 bits (129), Expect = 7.868e-104
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  184 RGARVLVVCSEITAVTFRGPVDTHLDS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 5.063e-103
Identity = 166/179 (92.74%), Postives = 172/179 (96.09%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            TV+ IR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 183          

HSP 2 Score: 55.8398 bits (133), Expect = 5.063e-103
Identity = 26/27 (96.30%), Postives = 27/27 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGPADTHLDS
Sbjct:  184 RGARVLVVCSEITAVTFRGPADTHLDS 210          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 340.117 bits (871), Expect = 1.914e-102
Identity = 165/181 (91.16%), Postives = 173/181 (95.58%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            MA+V+EIR AQRA GPATVLAIGTATP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYMAPSLDARQ IVVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 1.914e-102
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 7.235e-102
Identity = 163/181 (90.06%), Postives = 175/181 (96.69%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+EIRNAQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 7.235e-102
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 3.568e-101
Identity = 162/181 (89.50%), Postives = 174/181 (96.13%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 3.568e-101
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 7.924e-101
Identity = 161/181 (88.95%), Postives = 174/181 (96.13%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 7.924e-101
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 7.924e-101
Identity = 161/181 (88.95%), Postives = 174/181 (96.13%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 54.299 bits (129), Expect = 7.924e-101
Identity = 25/27 (92.59%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP DTHLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDS 208          
BLAST of FC876218 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.349e-100
Identity = 161/181 (88.95%), Postives = 173/181 (95.58%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN 595
            M TV+E+R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENN 181          

HSP 2 Score: 52.7582 bits (125), Expect = 1.349e-100
Identity = 24/27 (88.89%), Postives = 26/27 (96.30%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDS 675
            +GARVLVVCSEITAVTFRGP+D HLDS
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDS 208          
The following BLAST results are available for this feature:
BLAST of FC876218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_CITSI4.149e-111100.00Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS2_RUTGR2.715e-10493.85Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS3_RUTGR7.868e-10493.85Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS1_RUTGR5.063e-10392.74Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE1.914e-10291.16Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS3_SOYBN7.235e-10290.06Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS1_SOYBN3.568e-10189.50Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHS5_SOYBN7.924e-10188.95Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS2_SOYBN7.924e-10188.95Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHS2_CAMSI1.349e-10088.95Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H02EF DevOvary1 Citrus clementina cDNA clone C32001H02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876218 ID=FC876218|Name=FC876218|organism=Citrus clementina|type=EST|length=675bp
GACACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGTGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCGGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCT
back to top