FC876219

Overview
NameFC876219
Unique NameFC876219
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13037 contig Ccv1_Contig13037:205..911. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876219 vs. ExPASy Swiss-Prot
Match: AFMID_MOUSE (Probable arylformamidase OS=Mus musculus GN=Afmid PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.575e-11
Identity = 38/114 (33.33%), Postives = 59/114 (51.75%), Query Frame = 1
Query:  355 VVYGDQPRNRLDLHFPTNNDGPKPVVVFVTGGAWIIGYKAWGSLLGRQLAERDIIVACLDYRNFPQGTISDMVKDVSQGISFVFNNIADYGGDPNRIYLMGQSAGAHISSCALL 696
            V YGD    +LD++FP  +    P+ +F+ GG W  G K   + +   L  + I+V  + Y   P+GT+  MV  V++ + F+        G    IYL G SAGAH+++  LL
Sbjct:   64 VPYGDGEGEKLDIYFPDEDSKAFPLFLFLHGGYWQSGSKDDSAFMVNPLTAQGIVVVIVAYDIAPKGTLDQMVDQVTRSVVFLQRRYPSNEG----IYLCGHSAGAHLAAMVLL 173          
The following BLAST results are available for this feature:
BLAST of FC876219 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
AFMID_MOUSE6.575e-1133.33Probable arylformamidase OS=Mus musculus GN=Afmid ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32001H03EF DevOvary1 Citrus clementina cDNA clone C32001H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876219 ID=FC876219|Name=FC876219|organism=Citrus clementina|type=EST|length=707bp
GGTGGAAAATAGACAATTAACATTATGAATGACGATATGGAGACCGAACC
GATGGTGTCGTTTGGTCCCTCTAGTAATTATGTGGGAAGCAACAATCAGC
AGAGGCGCCGGAGACCCGCCGGAAGCAAGCCGGAGAAGCCACGACGGCAG
AATTCGTTTAGCCGAGATATTGGGCACGCTGCCGCTGAGACTTATCTTAT
CACCAGGCTAACCTTCACTCTTCTTCGATATCTTGGGTTAGGCTATCGGT
GGATCTCAAGATTGGTTGCTCTCGGTTGTTATGCTATGTTACTTCTGCCC
GGCTTTCTCCAAGTTGCCTATTATTATTTTTTCTCGAGCCAAGTCAGGCG
GAGTGTTGTTTATGGAGATCAACCCAGAAATAGGTTGGACCTACATTTTC
CCACAAATAATGATGGACCGAAGCCAGTTGTGGTGTTTGTAACTGGTGGA
GCCTGGATTATTGGGTACAAAGCGTGGGGTTCTCTTCTAGGAAGGCAATT
GGCGGAAAGAGACATTATAGTTGCATGCCTTGATTATAGAAATTTTCCCC
AGGGAACTATCAGTGACATGGTGAAAGACGTTTCTCAGGGCATCTCGTTT
GTCTTCAACAACATTGCTGATTATGGAGGTGATCCTAACAGGATTTATCT
AATGGGGCAATCAGCTGGTGCACATATTTCTTCTTGTGCTCTCTTGGAGC
CAGCAGT
back to top