FC876221

Overview
NameFC876221
Unique NameFC876221
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:7..724. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 441.039 bits (1133), Expect = 2.915e-123
Identity = 220/222 (99.10%), Postives = 220/222 (99.10%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVG ALFGDGAAAV
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 4.508e-116
Identity = 206/220 (93.64%), Postives = 212/220 (96.36%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+EIR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDSLVG ALFGDGAAAV
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 224          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.312e-115
Identity = 205/220 (93.18%), Postives = 212/220 (96.36%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+EIR AQRADGPATVLAIGTATPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPVDTHLDSLVGQALFGDGAAAV 224          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 8.501e-115
Identity = 204/220 (92.73%), Postives = 211/220 (95.91%), Query Frame = 1
Query:   58 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            TV+ IR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYMAPSL ARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCSEITAVTFRGPADTHLDSLVG ALFGDGAAAV
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAV 224          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 1.450e-114
Identity = 203/222 (91.44%), Postives = 211/222 (95.05%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            MA+V+EIR AQRA GPATVLAIGTATP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYMAPSL ARQ IVVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 5.510e-114
Identity = 201/222 (90.54%), Postives = 213/222 (95.95%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+EIRNAQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 2.735e-113
Identity = 200/222 (90.09%), Postives = 212/222 (95.50%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 6.092e-113
Identity = 199/222 (89.64%), Postives = 212/222 (95.50%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSL ARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 6.092e-113
Identity = 199/222 (89.64%), Postives = 212/222 (95.50%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSL ARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP DTHLDSLVG ALFGDGAAAV
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAV 222          
BLAST of FC876221 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.357e-112
Identity = 197/222 (88.74%), Postives = 211/222 (95.05%), Query Frame = 1
Query:   52 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLGARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGPALFGDGAAAV 717
            M TV+E+R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSL ARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGP+D HLDSLVG ALFGDGAAA+
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAI 222          
The following BLAST results are available for this feature:
BLAST of FC876221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 146
Match NameE-valueIdentityDescription
CHS2_CITSI2.915e-12399.10Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS2_RUTGR4.508e-11693.64Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS3_RUTGR1.312e-11593.18Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS1_RUTGR8.501e-11592.73Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE1.450e-11491.44Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS3_SOYBN5.510e-11490.54Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS1_SOYBN2.735e-11390.09Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHS5_SOYBN6.092e-11389.64Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS2_SOYBN6.092e-11389.64Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHS2_CAMSI1.357e-11288.74Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001H09EF DevOvary1 Citrus clementina cDNA clone C32001H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876221 ID=FC876221|Name=FC876221|organism=Citrus clementina|type=EST|length=718bp
GAACTCACCAAGCACGAGCCACAAACATATTCATTAAGGGTTCAACTTGA
AATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGG
CCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCAG
GCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGAC
GGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAGA
AGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATG
TGCGCTTACATGGCTCCATCACTCGGCGCACGCCAAGACATTGTGGTGGT
CGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAAT
GGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTCC
GGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCCT
GCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCCG
GCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCCAGCTTTGTTCGGTG
ATGGTGCTGCTGCTGTGA
back to top