FC876224

Overview
NameFC876224
Unique NameFC876224
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10322 contig Ccv1_Contig10322:7..515. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_MAGLI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Magnolia liliiflora GN=GAPC PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 3.347e-64
Identity = 120/144 (83.33%), Postives = 123/144 (85.42%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFITTDYMTYM KYDSVHGQWKHHELKVKD KTLLFGEKPVTVFGVRNPEEIPW ETGAE+VVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK  +
Sbjct:    5 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDSKTLLFGEKPVTVFGVRNPEEIPWGETGAEFVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSNI 148          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 9.740e-64
Identity = 119/146 (81.51%), Postives = 124/146 (84.93%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M KVKIGINGFGRIGRLVARVILQ DD ELVA+NDPFITTDYMTYM KYDSVHGQWKHHELKVKD+KTLLFGE+PVTVFG RNPEEIPW +TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYK EL
Sbjct:    1 MAKVKIGINGFGRIGRLVARVILQSDDCELVAINDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGERPVTVFGNRNPEEIPWGQTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKSEL 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 4.834e-63
Identity = 114/144 (79.17%), Postives = 126/144 (87.50%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K++IGINGFGRIGRLVARV+LQRDDVELVAVNDPFITT+YMTYM KYDSVHGQWKH+ELK+KD+KTLLFGEKPVTVFG+RNPE+IPWAE GA+YVVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    5 KIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_PETHY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Petunia hybrida GN=GAPC PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 2.399e-62
Identity = 116/146 (79.45%), Postives = 122/146 (83.56%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M K+KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+ +YMTYM KYDSVHGQWKHHELK KDDKTLLFGEKPVTVFG+RNPEEIPW E GA+YVVESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:    1 MAKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISVEYMTYMFKYDSVHGQWKHHELKAKDDKTLLFGEKPVTVFGIRNPEEIPWGEAGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 236.884 bits (603), Expect = 4.092e-62
Identity = 114/144 (79.17%), Postives = 125/144 (86.81%), Query Frame = 3
Query:   78 KVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            K+KIGINGFGRIGRLVARVILQR+DVELVAVNDPFITT+YMTYM KYDSVHGQWKH+ELKVKD+KTLLFGEKPVTVFG+RNPE+IPW E GA++VVESTGVFT               V+ISAPSKDAPMFVVGVNEHEYK +L
Sbjct:    5 KIKIGINGFGRIGRLVARVILQRNDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNELKVKDEKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEHEYKSDL 148          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 4.092e-62
Identity = 116/146 (79.45%), Postives = 123/146 (84.25%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M  +KIGINGFGRIGRLVARVILQR+D ELVAVNDPFITT+YMTYM KYDSVHGQWKHH++KVKD+KTLLFGEK VTVFG RNPEEIPW  TGA+YVVESTGVFT               VIISAPSKDAPMFVVGVNEHEYKPEL
Sbjct:    1 MAPIKIGINGFGRIGRLVARVILQREDCELVAVNDPFITTEYMTYMFKYDSVHGQWKHHDIKVKDEKTLLFGEKAVTVFGNRNPEEIPWGGTGADYVVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEHEYKPEL 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_RANAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ranunculus acris GN=GAPC PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 3.464e-61
Identity = 114/145 (78.62%), Postives = 121/145 (83.45%), Query Frame = 3
Query:   75 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            GK+KIGINGFGRIGRLVARV L RDDVELVAVNDPFITTDYMTYM KYD+VHGQWKHHELKVKD+KTLLFGEKPVTVFG RNPEEIPW ETGAE+VVESTGVFT               V+ISAPS DAPMFVVGVN  EYK ++
Sbjct:    3 GKIKIGINGFGRIGRLVARVALARDDVELVAVNDPFITTDYMTYMFKYDTVHGQWKHHELKVKDEKTLLFGEKPVTVFGCRNPEEIPWGETGAEFVVESTGVFTTKEKASAHLKGGAKKVVISAPSADAPMFVVGVNHTEYKSDI 147          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 5.909e-61
Identity = 113/145 (77.93%), Postives = 120/145 (82.76%), Query Frame = 3
Query:   75 GKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            GK+KIGINGFGRIGRLVARV L RDD+ELVAVNDPFI+TDYMTYM KYDSVHGQWK HE+KVKD  TLLFGEK VTVFG RNPEEIPW ETG EYVVESTGVFT               V+I+APSKDAPMFVVGVNEHEYKP+L
Sbjct:    5 GKIKIGINGFGRIGRLVARVALLRDDIELVAVNDPFISTDYMTYMFKYDSVHGQWKKHEVKVKDSNTLLFGEKAVTVFGCRNPEEIPWGETGVEYVVESTGVFTDKEKAAAHIKGGAKKVVITAPSKDAPMFVVGVNEHEYKPDL 149          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 3.830e-60
Identity = 114/146 (78.08%), Postives = 121/146 (82.88%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M KVKIGINGFGRIGRLVARV L RDDVELVAVNDPFIT DYM YM KYD+VHGQ+KHHELKVKD+KTLLFG+KPV VFG+RNPEEIPWAETGAEYVVESTGVFT               VIISAPSKDAPMFVVGVNE  Y P++
Sbjct:    1 MAKVKIGINGFGRIGRLVARVALVRDDVELVAVNDPFITVDYMAYMFKYDTVHGQYKHHELKVKDEKTLLFGDKPVAVFGLRNPEEIPWAETGAEYVVESTGVFTEKEKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDI 146          
BLAST of FC876224 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 8.532e-60
Identity = 115/146 (78.77%), Postives = 120/146 (82.19%), Query Frame = 3
Query:   72 MGKVKIGINGFGRIGRLVARVILQRDDVELVAVNDPFITTDYMTYMCKYDSVHGQWKHHELKVKDDKTLLFGEKPVTVFGVRNPEEIPWAETGAEYVVESTGVFTXXXXXXXXXXXXXXXVIISAPSKDAPMFVVGVNEHEYKPEL 509
            M  +KIGINGFGRIGRLVARV LQRDDVELVAVNDPFI+TDYMTYM KYDSVHG WKHHELKVKD+KTLLFGEKPV VFG RNPEEIP A TGAEY+VESTGVFT               VIISAPSKDAPMFVVGVNE EYK +L
Sbjct:    1 MAPIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGAWKHHELKVKDEKTLLFGEKPVVVFGRRNPEEIPRASTGAEYIVESTGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKEYKSDL 146          
The following BLAST results are available for this feature:
BLAST of FC876224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 307
Match NameE-valueIdentityDescription
G3PC_MAGLI3.347e-6483.33Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU9.740e-6481.51Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_ARATH4.834e-6379.17Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PETHY2.399e-6279.45Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL4.092e-6279.17Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_DIACA4.092e-6279.45Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_RANAC3.464e-6178.62Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI5.909e-6177.93Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL3.830e-6078.08Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA8.532e-6078.77Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A02EF DevOvary1 Citrus clementina cDNA clone C32002A02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876224 ID=FC876224|Name=FC876224|organism=Citrus clementina|type=EST|length=509bp
GGACTGCTCTCTCTACTCTCTACAACTTTCTTCACCACTCTTTCACCGCT
CAATTTCATCTCTCGAGAATCATGGGGAAGGTCAAGATCGGAATCAACGG
ATTCGGAAGAATTGGTAGGCTGGTGGCAAGAGTCATCTTGCAGAGGGACG
ATGTTGAACTCGTTGCTGTTAATGATCCCTTTATCACAACCGATTACATG
ACATACATGTGTAAGTACGACAGTGTTCACGGTCAATGGAAGCACCATGA
ATTGAAGGTTAAGGACGATAAGACCCTTCTCTTTGGTGAGAAGCCTGTCA
CTGTTTTCGGTGTTAGGAACCCAGAGGAGATCCCATGGGCTGAGACTGGA
GCCGAGTATGTTGTGGAGTCGACTGGAGTCTTTACAGACAAGGATAAGGC
TGCTGCCCATTTGAAGGGTGGTGCTAAGAAAGTTATCATCTCAGCCCCCA
GCAAGGATGCTCCTATGTTTGTTGTGGGTGTCAATGAGCACGAGTACAAA
CCAGAGCTC
back to top