FC876229

Overview
NameFC876229
Unique NameFC876229
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length464
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4005 contig Ccv1_Contig4005:28..491. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876229 vs. ExPASy Swiss-Prot
Match: ILV5_ARATH (Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 7.746e-40
Identity = 84/121 (69.42%), Postives = 97/121 (80.17%), Query Frame = 1
Query:  112 NLAFFSSTAKSLRALKTT----RGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLR 462
            N+ F SS++KSLR+L  T       GS+L A+M S +A+K P  LDFETSVFKK+ +SLA  +E+IVRGGRDLFK LPDAF GI QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVK+GLR
Sbjct:   36 NIGFLSSSSKSLRSLTATVAGNGATGSSLAARMVSSSAVKAPVSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIKQIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLR 156          
BLAST of FC876229 vs. ExPASy Swiss-Prot
Match: ILV5_PEA (Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 5.196e-36
Identity = 80/122 (65.57%), Postives = 92/122 (75.41%), Query Frame = 1
Query:   97 AFKHLNLAFFSSTAKSLRALKTTRGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLR 462
            +F   NL+F   + +S+RA ++    GSALGA   S      P  LDFETSVFKK+ ++LA  +E+IVRGGRDLF LLPDAF GI QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVKVGLR
Sbjct:   26 SFAPTNLSFSKLSPQSIRARRSITV-GSALGATKVSAPPATHPVSLDFETSVFKKERVNLAGHEEYIVRGGRDLFHLLPDAFKGIKQIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKVGLR 146          
BLAST of FC876229 vs. ExPASy Swiss-Prot
Match: ILV5_SPIOL (Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.579e-35
Identity = 80/129 (62.02%), Postives = 95/129 (73.64%), Query Frame = 1
Query:  109 LNLAFF--SSTAKSLRALKTTR-------GRGSALGAQMASETALKTPFL--LDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLR 462
            LNL F   SST K+ R+LK  R       G GSAL AQM S  ++ TP     DF++SVFKK+ ++L+  DE+IVRGGR+LF LLPDAF GI QIGVIGWGSQ PAQAQNL+DSL EAKSD+VVK+GLR
Sbjct:   34 LNLGFLGSSSTIKACRSLKAARVLPSGANGGGSALSAQMVSAPSINTPSATTFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGSQAPAQAQNLKDSLTEAKSDVVVKIGLR 162          
BLAST of FC876229 vs. ExPASy Swiss-Prot
Match: ILV5_ORYSJ (Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 4.260e-30
Identity = 69/105 (65.71%), Postives = 79/105 (75.24%), Query Frame = 1
Query:  148 RALKTTRGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLR 462
            RA+        A+GA M S         LDF+TSVF K+ +SLA  +E+IVRGGR+LF LLP+AF GI QIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVK+GLR
Sbjct:   49 RAVTAMVAAPPAVGAAMPS---------LDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKIGLR 144          
The following BLAST results are available for this feature:
BLAST of FC876229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ILV5_ARATH7.746e-4069.42Ketol-acid reductoisomerase, chloroplastic OS=Arab... [more]
ILV5_PEA5.196e-3665.57Ketol-acid reductoisomerase, chloroplastic OS=Pisu... [more]
ILV5_SPIOL2.579e-3562.02Ketol-acid reductoisomerase, chloroplastic OS=Spin... [more]
ILV5_ORYSJ4.260e-3065.71Ketol-acid reductoisomerase, chloroplastic OS=Oryz... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32002A10EF DevOvary1 Citrus clementina cDNA clone C32002A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876229 ID=FC876229|Name=FC876229|organism=Citrus clementina|type=EST|length=464bp
GGAGTCAAAAAAAACAAAATGGTGGCGGGTACTTTACCATCTAGTCCGTC
GATCCCCAAATTTAGTCCATCGCCGTCGTCCGAAACCCTAAAAGGAGCAT
TCAAGCATCTCAATCTAGCGTTTTTCTCATCCACCGCGAAGTCCTTGAGA
GCTCTCAAAACTACCAGAGGCAGGGGCTCAGCTCTCGGCGCTCAGATGGC
GTCCGAGACAGCTCTCAAGACACCTTTCTTGCTGGATTTTGAGACATCCG
TCTTTAAGAAGGACGCGATATCACTGGCTAACCGCGATGAGTTCATTGTG
AGAGGAGGAAGGGATTTGTTTAAGTTGCTGCCGGACGCATTCAACGGGAT
TAACCAGATTGGGGTGATTGGCTGGGGTTCCCAGGGACCTGCCCAAGCTC
AGAATTTGAGGGATTCCCTTGCTGAAGCTAAATCTGATATTGTTGTCAAG
GTTGGGCTTAGGAA
back to top