FC876230

Overview
NameFC876230
Unique NameFC876230
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length458
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10316 contig Ccv1_Contig10316:1..458. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_DICDI (Probable ATP-citrate synthase OS=Dictyostelium discoideum GN=acly PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.040e-25
Identity = 57/117 (48.72%), Postives = 80/117 (68.38%), Query Frame = 2
Query:  110 QLFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGAEG-FQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            +LF+K +QAL YNYK+  +QRMLDFD +  R+TPSV G+I+PG++G   K FFG +E+ IPV+++V  AC   P ADVF+NF             L++P+I+ V IIAEGVPE + +
Sbjct:   18 RLFTKQSQALIYNYKEAAVQRMLDFDNVSQRDTPSVGGLIHPGSDGGMYKAFFGFKELVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR 134          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACL1_SCHPO (Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe GN=SPBC1703.07 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 2.397e-22
Identity = 52/113 (46.02%), Postives = 70/113 (61.95%), Query Frame = 2
Query:  110 QLFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPE 445
            +LFSK T+A  Y  +   +Q MLDFD++CGR  PSVA II   G++   KL++G +EI +PV+ T+E AC  HP  DV +NF             ++ P IR +AIIAEGVPE
Sbjct:   11 ELFSKDTRAFVYGMQTKAVQGMLDFDYMCGRTVPSVAAIIYTFGSQSISKLYWGTKEILLPVYRTIEEACTKHPEVDVVVNFASSRSAYASTMELMEFPQIRCIAIIAEGVPE 123          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACL1_SORMA (ATP-citrate synthase subunit 1 OS=Sordaria macrospora GN=ACL1 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.231e-18
Identity = 47/112 (41.96%), Postives = 65/112 (58.04%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPE 445
            LF++ T+   Y  +   +Q MLDFDF+C R TPSVAGII   G +   K+++G  E  +PV+  V+ A A HP  DV +NF             ++ P I+ +AIIAEGVPE
Sbjct:   52 LFNEKTRCFVYGLQPRAVQGMLDFDFICKRSTPSVAGIIYTFGGQFVSKMYWGTSETLLPVYQEVQKAIAKHPDVDVVVNFASSRSVYSSTMELMEHPQIKTIAIIAEGVPE 163          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACL1_NEUCR (Probable ATP-citrate synthase subunit 1 OS=Neurospora crassa GN=B14D6.310 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 6.109e-18
Identity = 47/112 (41.96%), Postives = 63/112 (56.25%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPE 445
            LF+  T+   Y  +   +Q MLDFDF+C R TPSVAGII   G +   K+++G  E  +PV+  V  A A HP  DV +NF             ++ P I+ +AIIAEGVPE
Sbjct:   48 LFNDKTRCFVYGLQPRAVQGMLDFDFICKRSTPSVAGIIYTFGGQFVSKMYWGTSETLLPVYQEVPKAIAKHPDVDVVVNFASSRSVYSSTMELMEYPQIKTIAIIAEGVPE 159          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_SHEEP (ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.960e-17
Identity = 46/116 (39.66%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LFS+ T+A+ +  +   +Q MLDFD++C R+ PSVA ++ P   +  QK ++G +EI IPV   +  A   HP  DV INF             +    IR +AIIAEG+PEA T+
Sbjct:  492 LFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYTQIRTIAIIAEGIPEALTR 607          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_RAT (ATP-citrate synthase OS=Rattus norvegicus GN=Acly PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.960e-17
Identity = 46/116 (39.66%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LFS+ T+A+ +  +   +Q MLDFD++C R+ PSVA ++ P   +  QK ++G +EI IPV   +  A   HP  DV INF             +    IR +AIIAEG+PEA T+
Sbjct:  491 LFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTR 606          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_MOUSE (ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.960e-17
Identity = 46/116 (39.66%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LFS+ T+A+ +  +   +Q MLDFD++C R+ PSVA ++ P   +  QK ++G +EI IPV   +  A   HP  DV INF             +    IR +AIIAEG+PEA T+
Sbjct:  482 LFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTR 597          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_HUMAN (ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 SV=3)

HSP 1 Score: 87.0409 bits (214), Expect = 3.960e-17
Identity = 46/116 (39.66%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LFS+ T+A+ +  +   +Q MLDFD++C R+ PSVA ++ P   +  QK ++G +EI IPV   +  A   HP  DV INF             +    IR +AIIAEG+PEA T+
Sbjct:  492 LFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTR 607          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_BOVIN (ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 3.960e-17
Identity = 46/116 (39.66%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LFS+ T+A+ +  +   +Q MLDFD++C R+ PSVA ++ P   +  QK ++G +EI IPV   +  A   HP  DV INF             +    IR +AIIAEG+PEA T+
Sbjct:  482 LFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTR 597          
BLAST of FC876230 vs. ExPASy Swiss-Prot
Match: ACLY_CAEEL (Probable ATP-citrate synthase OS=Caenorhabditis elegans GN=D1005.1 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 6.755e-17
Identity = 46/116 (39.66%), Postives = 65/116 (56.03%), Query Frame = 2
Query:  113 LFSKTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINP-GAEGFQKLFFGQEEIAIPVHSTVEAACAAHPMADVFINFXXXXXXXXXXXXXLKQPTIRVVAIIAEGVPEADTK 457
            LF   T+A+ +  +   IQ MLDFD++C R +PSV     P   +  QK +FGQ+EI IP + ++  A A HP A + + F             L+ P I+V+AIIAEGVPE  T+
Sbjct:  492 LFEDDTKAIIWGQQAKAIQGMLDFDYVCRRSSPSVVASTYPFTGDNKQKYYFGQKEILIPAYKSMAKAFATHPDASIMVTFASMRSVFETVLEALEFPQIKVIAIIAEGVPENQTR 607          
The following BLAST results are available for this feature:
BLAST of FC876230 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
ACLY_DICDI1.040e-2548.72Probable ATP-citrate synthase OS=Dictyostelium dis... [more]
ACL1_SCHPO2.397e-2246.02Probable ATP-citrate synthase subunit 1 OS=Schizos... [more]
ACL1_SORMA1.231e-1841.96ATP-citrate synthase subunit 1 OS=Sordaria macrosp... [more]
ACL1_NEUCR6.109e-1841.96Probable ATP-citrate synthase subunit 1 OS=Neurosp... [more]
ACLY_SHEEP3.960e-1739.66ATP-citrate synthase OS=Ovis aries GN=ACLY PE=2 SV... [more]
ACLY_RAT3.960e-1739.66ATP-citrate synthase OS=Rattus norvegicus GN=Acly ... [more]
ACLY_MOUSE3.960e-1739.66ATP-citrate synthase OS=Mus musculus GN=Acly PE=1 ... [more]
ACLY_HUMAN3.960e-1739.66ATP-citrate synthase OS=Homo sapiens GN=ACLY PE=1 ... [more]
ACLY_BOVIN3.960e-1739.66ATP-citrate synthase OS=Bos taurus GN=ACLY PE=2 SV... [more]
ACLY_CAEEL6.755e-1739.66Probable ATP-citrate synthase OS=Caenorhabditis el... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32002A11EF DevOvary1 Citrus clementina cDNA clone C32002A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876230 ID=FC876230|Name=FC876230|organism=Citrus clementina|type=EST|length=458bp
GGAATCGTCTCATTTCTCTTACCCTGTCTCGCATTGTATCGGCTGAGTTC
ACGAGGCAGGGACTCCGAGTCAGGTGTCTTCAGCGATTAGTGACGCCATG
GCTACAGGACAGCTGTTTTCAAAAACCACACAAGCTTTGTTTTACAACTA
TAAGCAGCTTCCAATCCAACGGATGCTTGATTTTGATTTCCTTTGCGGGA
GGGAAACACCTTCAGTTGCCGGAATTATAAATCCTGGGGCTGAGGGATTT
CAGAAATTGTTTTTTGGACAAGAGGAAATTGCCATTCCTGTGCATTCAAC
TGTTGAGGCAGCTTGTGCTGCTCATCCAATGGCTGATGTTTTCATCAACT
TTTCATCATTTAGAAGTGCGGCTGCCTCATCTATGGCTGCCCTGAAACAG
CCAACCATTCGGGTAGTGGCAATTATTGCCGAAGGTGTGCCTGAGGCAGA
CACCAAGC
back to top