FC876312

Overview
NameFC876312
Unique NameFC876312
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length615
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10348 contig Ccv1_Contig10348:84..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_ARATH (26S proteasome non-ATPase regulatory subunit 4 OS=Arabidopsis thaliana GN=MBP1 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 5.566e-87
Identity = 155/191 (81.15%), Postives = 174/191 (91.10%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGE-DDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIF 613
            MVLEAT+ICIDNSEWMRNGDY+PSR QAQTEA NL+CGAKTQ NPENTVG++TMAGKGVRVL TPTSDLGKILACMHGL++GGE+NL A IQ+AQLALKHRQNK Q+QRIIVF GSPIK+EKK LE++G++LKKNSV+LDIVNFGE DDE   +KLEALL AVNNND SH+VHVP G NALSDVLLSTP+F
Sbjct:    1 MVLEATMICIDNSEWMRNGDYSPSRLQAQTEAVNLLCGAKTQSNPENTVGILTMAGKGVRVLTTPTSDLGKILACMHGLDVGGEINLTAAIQIAQLALKHRQNKNQRQRIIVFAGSPIKYEKKALEIVGKRLKKNSVSLDIVNFGEDDDEEKPQKLEALLTAVNNNDGSHIVHVPSGANALSDVLLSTPVF 191          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_DICDI (26S proteasome non-ATPase regulatory subunit 4 OS=Dictyostelium discoideum GN=psmD4 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.437e-58
Identity = 109/189 (57.67%), Postives = 144/189 (76.19%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPI 610
            M LEAT++C+DNSEWMRNGD+ PSR +AQ +A NLIC +KTQ NPE+ V +M+MAGK   VLVT T +L KIL+    L+I G+++ +  +Q+AQLAL+HRQN  Q  RII FVGSP+K  K+ L  + ++LKKN VA+DI+NFGE  E N++KLEA +  VNNND SHL+ VPPGP+ LSD++L +PI
Sbjct:    1 MTLEATIVCLDNSEWMRNGDFTPSRSEAQKDAVNLICASKTQSNPESAVSIMSMAGKKPEVLVTLTQELSKILSGAQELKINGKIDFSTTMQIAQLALRHRQNNHQHPRIIAFVGSPLKETKEELIQLAKRLKKNGVAVDIINFGEVTE-NSDKLEAFINDVNNNDESHLLTVPPGPHILSDIILQSPI 188          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_MOUSE (26S proteasome non-ATPase regulatory subunit 4 OS=Mus musculus GN=Psmd4 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.016e-49
Identity = 99/191 (51.83%), Postives = 138/191 (72.25%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            MVLE+T++C+DNSE+MRNGD+ P+R QAQ +A N++C +KT+ NPEN VG++T+A     VL T T D G+IL+ +H ++  G++    GI+VA LALKHRQ K  + RII FVGSP++  +K L  + ++LKK  V +DI+NFGE +E NTEKL A +  +N  D   SHLV VPPGP +L+D L+S+PI
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLAND-CEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGE-EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGP-SLADALISSPI 188          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_HUMAN (26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens GN=PSMD4 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.016e-49
Identity = 99/191 (51.83%), Postives = 138/191 (72.25%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            MVLE+T++C+DNSE+MRNGD+ P+R QAQ +A N++C +KT+ NPEN VG++T+A     VL T T D G+IL+ +H ++  G++    GI+VA LALKHRQ K  + RII FVGSP++  +K L  + ++LKK  V +DI+NFGE +E NTEKL A +  +N  D   SHLV VPPGP +L+D L+S+PI
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLAND-CEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGE-EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGP-SLADALISSPI 188          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_BOVIN (26S proteasome non-ATPase regulatory subunit 4 OS=Bos taurus GN=PSMD4 PE=2 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 6.016e-49
Identity = 99/191 (51.83%), Postives = 138/191 (72.25%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            MVLE+T++C+DNSE+MRNGD+ P+R QAQ +A N++C +KT+ NPEN VG++T+A     VL T T D G+IL+ +H ++  G++    GI+VA LALKHRQ K  + RII FVGSP++  +K L  + ++LKK  V +DI+NFGE +E NTEKL A +  +N  D   SHLV VPPGP +L+D L+S+PI
Sbjct:    1 MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLAND-CEVLTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDIINFGE-EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGP-SLADALISSPI 188          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: RPN10_SCHPO (26S proteasome regulatory subunit rpn10 OS=Schizosaccharomyces pombe GN=rpn10 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.935e-47
Identity = 95/189 (50.26%), Postives = 128/189 (67.72%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPI 610
            MVLEAT+I IDNSEWM NGDY P+RF+AQ +  ++I   K   NPEN  G+MT+     +VL T T D GK L+ MH L + G      GIQ+AQLALKHR+NK Q+QRI+ FVGSPI  ++K L  + +++KKN+VA+DI++ GE    N   L+  + A N++DS HLV +PP P  LSD++  +PI
Sbjct:    1 MVLEATMILIDNSEWMINGDYIPTRFEAQKDTVHMIFNQKINDNPENMCGLMTIGDNSPQVLSTLTRDYGKFLSAMHDLPVRGNAKFGDGIQIAQLALKHRENKIQRQRIVAFVGSPIVEDEKNLIRLAKRMKKNNVAIDIIHIGELQ--NESALQHFIDAANSSDSCHLVSIPPSPQLLSDLVNQSPI 187          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: RPN10_YEAST (26S proteasome regulatory subunit RPN10 OS=Saccharomyces cerevisiae GN=RPN10 PE=1 SV=3)

HSP 1 Score: 187.193 bits (474), Expect = 5.631e-47
Identity = 99/191 (51.83%), Postives = 136/191 (71.20%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNN--NDSSHLVHVPPGPNALSDVLLSTPI 610
            MVLEAT++ IDNSE+ RNGD+  +RF+AQ ++   I  AK   NPENTVG+++ AG   RVL T T++ GKILA +H  +I G+L++A  +Q+AQL LKHRQNK Q QRI+ FV SPI   +  L  + + LKKN+VA+DI+NFGE ++ NTE L+  +AAVNN   ++SHL+ V PGP  L + + S+PI
Sbjct:    1 MVLEATVLVIDNSEYSRNGDFPRTRFEAQIDSVEFIFQAKRNSNPENTVGLISGAGANPRVLSTFTAEFGKILAGLHDTQIEGKLHMATALQIAQLTLKHRQNKVQHQRIVAFVCSPISDSRDELIRLAKTLKKNNVAVDIINFGEIEQ-NTELLDEFIAAVNNPQEETSHLLTVTPGPRLLYENIASSPI 190          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_DROME (26S proteasome non-ATPase regulatory subunit 4 OS=Drosophila melanogaster GN=Pros54 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 2.003e-44
Identity = 99/191 (51.83%), Postives = 128/191 (67.02%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            MVLE+T+IC DNS++ RNGDY P+R   Q +  NL+C  K + NPEN VG+MT++   V VL T TSD G+I + MH ++  GE+NL  GI++A L LKHRQ K  + RI+VFVGSPI HE+  L    ++LKK  V +DIV+FG D   N E L A + A+N  D   SHLV VP G + LSD LLS+PI
Sbjct:    1 MVLESTMICFDNSDFQRNGDYFPTRLIVQRDGINLVCLTKLRSNPENNVGLMTLSNT-VEVLATLTSDAGRIFSKMHLVQPKGEINLLTGIRIAHLVLKHRQGKNHKMRIVVFVGSPINHEEGDLVKQAKRLKKEKVNVDIVSFG-DHGNNNEILTAFINALNGKDGTGSHLVSVPRG-SVLSDALLSSPI 188          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PIPSL_HUMAN (Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens GN=PIPSL PE=5 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.754e-40
Identity = 90/189 (47.62%), Postives = 124/189 (65.61%), Query Frame = 2
Query:   50 LEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            L+     +DNSE+M NGD+ P+R QAQ +A N +C +KT+ NPEN VG++T+      VL T T D G+IL+ +H ++  G++    GI VA LALKHRQ    + RII FVG+P++  +K L  + + LKK  V +DI+NFGE +E NTEKL A +  +N  D   SHLV VPPGP +L+D L+S PI
Sbjct:  488 LQMLTTSVDNSEYMGNGDFLPTRLQAQQDAVNTVCHSKTRSNPENNVGLITL-DNDCEVLTTLTPDTGRILSKLHTVQPKGKITFCMGIHVAHLALKHRQGNNHKIRIIAFVGNPVEDNEKNLVKLAKCLKKEKVNVDIINFGE-EEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGP-SLADALISFPI 673          
BLAST of FC876312 vs. ExPASy Swiss-Prot
Match: PSMD4_SCHMA (26S proteasome non-ATPase regulatory subunit 4 OS=Schistosoma mansoni PE=2 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 8.707e-40
Identity = 85/191 (44.50%), Postives = 127/191 (66.49%), Query Frame = 2
Query:   44 MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNND--SSHLVHVPPGPNALSDVLLSTPI 610
            M  EAT+I +DNS++MRNGD+ P+R QAQ +A  LIC +K Q NPENT+G++++A     VL T T+D+ KI   +H +E  G +   + I++A LAL+HRQ + Q+ RI+ F+GSPI  ++K L  + ++LKK  V +DI+NFGE +E N +KL   +  +N  D   SHL+ V PG   L D L+++P+
Sbjct:    1 MSQEATIIAVDNSDYMRNGDFFPTRLQAQNDAVGLICQSKRQRNPENTIGLLSLAN--TEVLCTLTNDVSKIYNRLHLVEPKGRIIFCSSIRIAHLALRHRQLRHQKMRIVCFIGSPILEDEKELTRLAKRLKKEKVNVDIINFGE-NETNEQKLSEFIDTLNGKDGTGSHLISVAPG-TVLHDTLMTSPV 187          
The following BLAST results are available for this feature:
BLAST of FC876312 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
PSMD4_ARATH5.566e-8781.1526S proteasome non-ATPase regulatory subunit 4 OS=... [more]
PSMD4_DICDI2.437e-5857.6726S proteasome non-ATPase regulatory subunit 4 OS=... [more]
PSMD4_MOUSE6.016e-4951.8326S proteasome non-ATPase regulatory subunit 4 OS=... [more]
PSMD4_HUMAN6.016e-4951.8326S proteasome non-ATPase regulatory subunit 4 OS=... [more]
PSMD4_BOVIN6.016e-4951.8326S proteasome non-ATPase regulatory subunit 4 OS=... [more]
RPN10_SCHPO1.935e-4750.2626S proteasome regulatory subunit rpn10 OS=Schizos... [more]
RPN10_YEAST5.631e-4751.8326S proteasome regulatory subunit RPN10 OS=Sacchar... [more]
PSMD4_DROME2.003e-4451.8326S proteasome non-ATPase regulatory subunit 4 OS=... [more]
PIPSL_HUMAN1.754e-4047.62Putative PIP5K1A and PSMD4-like protein OS=Homo sa... [more]
PSMD4_SCHMA8.707e-4044.5026S proteasome non-ATPase regulatory subunit 4 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32003C03EF DevOvary1 Citrus clementina cDNA clone C32003C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876312 ID=FC876312|Name=FC876312|organism=Citrus clementina|type=EST|length=615bp
GATTGGCATTTGTTCTGTTTCTGATCTCAAAGAGTAGATAGCCATGGTTC
TCGAGGCAACGTTGATCTGTATTGATAATTCTGAGTGGATGCGTAACGGC
GATTACGCTCCTAGTAGATTCCAAGCTCAAACTGAAGCTGCTAATCTTAT
TTGCGGAGCCAAAACTCAGTTAAATCCTGAGAATACCGTAGGTGTTATGA
CAATGGCAGGGAAAGGGGTTCGTGTTTTGGTCACTCCTACTAGTGATCTT
GGCAAGATCTTGGCTTGCATGCACGGTTTAGAAATAGGCGGTGAGTTGAA
TCTTGCTGCTGGGATCCAGGTGGCTCAATTGGCTCTAAAGCATCGCCAGA
ACAAAAAGCAGCAACAAAGGATTATTGTCTTCGTTGGAAGTCCCATCAAG
CATGAAAAGAAAGTGCTGGAGATGATTGGCAGGAAGTTGAAAAAGAATAG
TGTAGCACTTGACATTGTCAACTTTGGTGAAGACGATGAGGGGAATACGG
AGAAGCTTGAAGCACTTCTTGCTGCTGTGAACAACAATGATAGTAGCCAC
CTTGTTCACGTTCCTCCTGGTCCAAATGCCCTTTCTGATGTGCTTCTTAG
TACGCCTATCTTCAC
back to top