FC876324

Overview
NameFC876324
Unique NameFC876324
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length551
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9430 contig Ccv1_Contig9430:32..581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_SOYBN (Fructose-1,6-bisphosphatase, chloroplastic OS=Glycine max GN=FBP PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.595e-60
Identity = 121/154 (78.57%), Postives = 135/154 (87.66%), Query Frame = 2
Query:   89 SRLSPYQICVFDSKALVSSCPSNVLKRRHVGVAAGVRCMAVGTTSEVATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            SRL P+Q+CVFD+K ++SS      +RRHVG  +GVRCMAVG  +   TKKRS YE++TLT+WLLKQEQ+GVIDAELTIVLSSIS ACKQIASLVQRA ISNLTG+QGAVNVQGEDQKKLDV SNEVFSNCLRSSGRTGIIASEEEDVP+AVEE
Sbjct:   19 SRLCPFQLCVFDTKQVLSSG-----RRRHVG-GSGVRCMAVGEAATTGTKKRSGYELQTLTSWLLKQEQAGVIDAELTIVLSSISMACKQIASLVQRANISNLTGVQGAVNVQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEE 166          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_PEA (Fructose-1,6-bisphosphatase, chloroplastic OS=Pisum sativum GN=FBP PE=1 SV=2)

HSP 1 Score: 214.157 bits (544), Expect = 3.442e-55
Identity = 118/155 (76.13%), Postives = 132/155 (85.16%), Query Frame = 2
Query:   89 SRLSPYQICVFDSKALVSSCPSNVLKRRHVGVAAGVRCMAVG-TTSEVATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            SRL P+Q+CVFD+K+++SS      +R+HV   +GVRCMAV   TSE  TKKRS YEI TLT+WLL+QEQ G+IDAELTIVLSSIS ACKQIASLVQRA ISNLTG QGAVN+QGEDQKKLDV SNEVFSNCLRSSGRTGIIASEEEDV +AVEE
Sbjct:   19 SRLCPFQLCVFDAKSVLSSS-----RRKHVN-GSGVRCMAVKEATSE--TKKRSGYEIITLTSWLLQQEQKGIIDAELTIVLSSISMACKQIASLVQRANISNLTGTQGAVNIQGEDQKKLDVISNEVFSNCLRSSGRTGIIASEEEDVAVAVEE 165          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_SPIOL (Fructose-1,6-bisphosphatase, chloroplastic OS=Spinacia oleracea PE=1 SV=2)

HSP 1 Score: 203.371 bits (516), Expect = 6.075e-52
Identity = 116/156 (74.36%), Postives = 127/156 (81.41%), Query Frame = 2
Query:   89 SRLSPYQICVFDSKALVSSCPSNVLKRRHVGVAAGVRCMA-VG-TTSEVATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            S LSP Q C+  +K+L S   +     RH  VA+GVRCMA VG   +E   + RS YEIETLT WLLKQE +GVIDAELTIVLSSIS ACKQIASLVQRAGISNLTGIQGAVN+QGEDQKKLDV SNEVFS+CLRSSGRTGIIASEEEDVP+AVEE
Sbjct:   24 STLSPSQQCITFTKSLHSFPTAT----RH-NVASGVRCMAAVGEAATETKARTRSKYEIETLTGWLLKQEMAGVIDAELTIVLSSISLACKQIASLVQRAGISNLTGIQGAVNIQGEDQKKLDVVSNEVFSSCLRSSGRTGIIASEEEDVPVAVEE 174          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_ARATH (Fructose-1,6-bisphosphatase, chloroplastic OS=Arabidopsis thaliana GN=FBP PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 4.813e-49
Identity = 104/141 (73.76%), Postives = 116/141 (82.27%), Query Frame = 2
Query:  152 SNVLKRRHVGV-----AAGVRCMAVGTTS---EVATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            SN  KR   GV     A+GVRCMAV   +   + A +K+S YE++TLT WLL+QE  G IDAELTIV+SSIS ACKQIASLVQRAGISNLTG+QGAVN+QGEDQKKLDV SNEVFSNCLRSSGRTGIIASEEEDVP+AVEE
Sbjct:   37 SNNGKRAPTGVRNHQYASGVRCMAVAADAAETKTAARKKSGYELQTLTGWLLRQEMKGEIDAELTIVMSSISLACKQIASLVQRAGISNLTGVQGAVNIQGEDQKKLDVISNEVFSNCLRSSGRTGIIASEEEDVPVAVEE 177          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_BRANA (Fructose-1,6-bisphosphatase, chloroplastic OS=Brassica napus GN=FBP PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 4.075e-48
Identity = 105/141 (74.47%), Postives = 116/141 (82.27%), Query Frame = 2
Query:  149 PSNVLKRRHVGV---AAGVRCMAVGT--TSEV--ATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            PS   KR  VG    A GVRCMAV    T+E   A KK+S YE++TLT+WLL+QE  G ID ELTIV+SSI+ ACKQIASLVQRAGISNLTG+QGAVN+QGEDQKKLDV SNEVFSNCLRSSGRTGIIASEEEDVP+AVEE
Sbjct:   32 PSLSGKRVAVGKNHHATGVRCMAVAADATAETKPAAKKKSGYELQTLTSWLLRQEMKGEIDTELTIVMSSIAMACKQIASLVQRAGISNLTGVQGAVNIQGEDQKKLDVVSNEVFSNCLRSSGRTGIIASEEEDVPVAVEE 172          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_ORYSJ (Fructose-1,6-bisphosphatase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0267300 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 7.685e-47
Identity = 100/126 (79.37%), Postives = 108/126 (85.71%), Query Frame = 2
Query:  185 AAGVRCMA-VGTTSEVAT---KKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            A  VRCMA V T S  A     K+SSYEI TLT WLLKQEQ+G ID E+TIVL+SISTACKQIASLVQRA ISNLTG+QGAVNVQGEDQKKLDV SNEVFSNCL+SSGRTG+IASEEEDVP+AVEE
Sbjct:   42 APSVRCMAAVDTASAPAATEASKKSSYEITTLTTWLLKQEQAGTIDGEMTIVLASISTACKQIASLVQRAPISNLTGVQGAVNVQGEDQKKLDVVSNEVFSNCLKSSGRTGVIASEEEDVPVAVEE 167          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P1_WHEAT (Fructose-1,6-bisphosphatase, chloroplastic OS=Triticum aestivum GN=FBP PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.712e-46
Identity = 98/123 (79.67%), Postives = 106/123 (86.18%), Query Frame = 2
Query:  194 VRCMAVGTTSEV----ATKKRSSYEIETLTNWLLKQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEEDVPLAVEE 550
            VRCMAV  T+      A +KRSSY++ TLT WLLKQEQ GVID E+TIVLSSISTACKQIASLVQRA ISNLTG+QGA NVQGEDQKKLDV SNEVFSNCLR SGRTG+IASEEEDVP+AVEE
Sbjct:   48 VRCMAVVDTASAPAPAAARKRSSYDMITLTTWLLKQEQEGVIDNEMTIVLSSISTACKQIASLVQRAPISNLTGVQGATNVQGEDQKKLDVISNEVFSNCLRWSGRTGVIASEEEDVPVAVEE 170          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_ORYSJ (Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sativa subsp. japonica GN=Os01g0866400 PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 8.287e-17
Identity = 45/93 (48.39%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            ++ T+T ++L +Q ++     +LTI+LS I   CK +AS V +AG++ L G+ G  NVQGE+QKKLDV SNEVF   L SSGRT ++ SEE++
Sbjct:   11 DLMTITRYVLNEQSRNPEARGDLTILLSHIVLGCKFVASAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEEDE 103          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_ORYSI (Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sativa subsp. indica GN=OsI_04558 PE=2 SV=2)

HSP 1 Score: 86.6557 bits (213), Expect = 8.287e-17
Identity = 45/93 (48.39%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            ++ T+T ++L +Q ++     +LTI+LS I   CK +AS V +AG++ L G+ G  NVQGE+QKKLDV SNEVF   L SSGRT ++ SEE++
Sbjct:   11 DLMTITRYVLNEQSRNPEARGDLTILLSHIVLGCKFVASAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEEDE 103          
BLAST of FC876324 vs. ExPASy Swiss-Prot
Match: F16P2_ORYCO (Fructose-1,6-bisphosphatase, cytosolic OS=Oryza coarctata PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.287e-17
Identity = 45/93 (48.39%), Postives = 65/93 (69.89%), Query Frame = 2
Query:  254 EIETLTNWLL-KQEQSGVIDAELTIVLSSISTACKQIASLVQRAGISNLTGIQGAVNVQGEDQKKLDVASNEVFSNCLRSSGRTGIIASEEED 529
            ++ T+T ++L +Q ++     +LTI+LS I   CK +AS V +AG++ L G+ G  NVQGE+QKKLDV SNEVF   L SSGRT ++ SEE++
Sbjct:   11 DLMTITRYVLNEQSRNPEARGDLTILLSHIVLGCKFVASAVNKAGLAKLIGLAGETNVQGEEQKKLDVLSNEVFVKALVSSGRTCVLVSEEDE 103          
The following BLAST results are available for this feature:
BLAST of FC876324 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
F16P1_SOYBN1.595e-6078.57Fructose-1,6-bisphosphatase, chloroplastic OS=Glyc... [more]
F16P1_PEA3.442e-5576.13Fructose-1,6-bisphosphatase, chloroplastic OS=Pisu... [more]
F16P1_SPIOL6.075e-5274.36Fructose-1,6-bisphosphatase, chloroplastic OS=Spin... [more]
F16P1_ARATH4.813e-4973.76Fructose-1,6-bisphosphatase, chloroplastic OS=Arab... [more]
F16P1_BRANA4.075e-4874.47Fructose-1,6-bisphosphatase, chloroplastic OS=Bras... [more]
F16P1_ORYSJ7.685e-4779.37Fructose-1,6-bisphosphatase, chloroplastic OS=Oryz... [more]
F16P1_WHEAT1.712e-4679.67Fructose-1,6-bisphosphatase, chloroplastic OS=Trit... [more]
F16P2_ORYSJ8.287e-1748.39Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sa... [more]
F16P2_ORYSI8.287e-1748.39Fructose-1,6-bisphosphatase, cytosolic OS=Oryza sa... [more]
F16P2_ORYCO8.287e-1748.39Fructose-1,6-bisphosphatase, cytosolic OS=Oryza co... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D06EF DevOvary1 Citrus clementina cDNA clone C32003D06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876324 ID=FC876324|Name=FC876324|organism=Citrus clementina|type=EST|length=551bp
GCGTAAAGCAGAAAGCAGAGGGCCAAAATGGTTGCAGCAGCAGCGACAGC
ATCATCACAGCTTCTCTTTTCAAGCTCTCACTCTTCTCTCTCGGCTCTCT
CCTTACCAAATATGTGTCTTCGACTCCAAAGCACTCGTGTCGTCATGTCC
CAGCAACGTTTTGAAGAGAAGACATGTTGGTGTTGCTGCTGGGGTTCGGT
GCATGGCTGTTGGGACAACATCGGAGGTTGCAACCAAGAAGAGAAGTTCG
TATGAGATTGAAACGCTGACAAACTGGCTGTTGAAGCAAGAACAGTCTGG
CGTTATTGATGCTGAGCTCACTATTGTGCTTTCCAGCATTTCAACGGCGT
GCAAGCAGATTGCTTCTTTGGTGCAAAGAGCTGGCATTTCCAACTTGACT
GGAATTCAGGGTGCTGTCAATGTTCAAGGCGAGGACCAGAAGAAGCTCGA
CGTCGCTTCAAATGAGGTGTTCTCAAACTGTTTGAGATCAAGTGGGCGAA
CCGGGATTATAGCGTCAGAGGAAGAGGATGTACCACTGGCGGTAGAAGAG
A
back to top