FC876326

Overview
NameFC876326
Unique NameFC876326
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15191 contig Ccv1_Contig15191:2..697. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.266e-83
Identity = 140/182 (76.92%), Postives = 157/182 (86.26%), Query Frame = 1
Query:   88 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            APE  HP+ AFGWAARDTSG LSP  FSRRATGE+DVTFKV +CGICHSDLH IKNEWGNA+YP +PGHEIVGVVTEVG+KV  FKVGDKVGVGCMVGSCRSC+SC   LENYCPK+I+TY S Y+DGT+TYGGYSD MV +EHF VRIP+   LDATAPLLCAG+TVYS L+ + LDKPG+
Sbjct:    5 APENVHPQKAFGWAARDTSGTLSPLKFSRRATGEQDVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGNKVQNFKVGDKVGVGCMVGSCRSCESCENHLENYCPKMILTYGSTYYDGTLTYGGYSDIMVVEEHFAVRIPDNMALDATAPLLCAGVTVYSPLKHFELDKPGL 186          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.399e-82
Identity = 139/182 (76.37%), Postives = 158/182 (86.81%), Query Frame = 1
Query:   88 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            A EQEH K A GWAARD+SGVLSPF+F RR TGEKDVTFKV +CGICHSDLH++KNEWG + YP+VPGHEIVG VTEVGSKV KFKVGD+VGVGC+VGSCRSC++C   LENYCPK I+TY +KY+DG+ TYGGYSD MVADEHF+VRIP+  PLD  APLLCAGIT YS LR++GLDKPGM
Sbjct:    2 AIEQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGM 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.312e-77
Identity = 130/185 (70.27%), Postives = 151/185 (81.62%), Query Frame = 1
Query:   79 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            M ++PE EHP  A GWAA D SG  SPF+FSRRATGE+DV F+V +CG+CHSDLH++KNEWG   YPIVPGHEIVG+VTEVGSKV K K+GDKVGVG +VGSCR CD C+ DLENYC K I+TY + Y DGTI  GGYSD MVADEHF++R PE  PLDA APLLCAGIT YS L+++GLDKPG+
Sbjct:    1 MAKSPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGLDKPGL 185          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 4.820e-75
Identity = 129/184 (70.11%), Postives = 149/184 (80.98%), Query Frame = 1
Query:   79 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            M ++ E EHP  AFGWAARDT+G+LSPF FSRRATGEKDV  KV  CG+CHSD H+I N WG   YPIVPGHEIVGVVTEVGSKV K KVGD VG+GC+VGSCRSC+SC  + E++C   I TY S Y DGT+T+GGYSDTMVADEHF++R P+  PLD+ APLLCAGIT YS L++YGLDKPG
Sbjct:    1 MAKSSEIEHPVKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPG 184          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.392e-74
Identity = 127/175 (72.57%), Postives = 146/175 (83.43%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            K AFG AA+D SGVLSPF F+RR TGEKDV FKV  CGICHSDLH++KNEWG + YP+VPGHEIVGVVTEVG+KV+KFK G+KVGVGC+V SC SCDSC   +ENYCPK I TY   Y+D TITYGGYSD MV +E FV+RIP+  PLDA APLLCAGITVYS ++++GLDKPGM
Sbjct:    7 KEAFGLAAKDNSGVLSPFSFTRRETGEKDVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGAKVTKFKTGEKVGVGCLVSSCGSCDSCTEGMENYCPKSIQTYGFPYYDNTITYGGYSDHMVCEEGFVIRIPDNLPLDAAAPLLCAGITVYSPMKYHGLDKPGM 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH7_ARATH (Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2)

HSP 1 Score: 260.766 bits (665), Expect = 5.162e-69
Identity = 121/175 (69.14%), Postives = 140/175 (80.00%), Query Frame = 1
Query:  109 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPGM 633
            K AFG AA+D SG+LSPF FSRRATGEKDV FKV  CGICH+DL + KNEWG   YP+VPGHEIVGVVTEVG+KV KF  GDKVGVG M GSCRSCDSC    ENYCPK+I+T  +K  D T+T+GGYSD MV  E F++RIP+  PLD  APLLCAG+TVYS ++++GLDKPGM
Sbjct:    7 KEAFGLAAKDESGILSPFSFSRRATGEKDVRFKVLFCGICHTDLSMAKNEWGLTTYPLVPGHEIVGVVTEVGAKVKKFNAGDKVGVGYMAGSCRSCDSCNDGDENYCPKMILTSGAKNFDDTMTHGGYSDHMVCAEDFIIRIPDNLPLDGAAPLLCAGVTVYSPMKYHGLDKPGM 181          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH9_ARATH (Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=1 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 5.707e-68
Identity = 113/184 (61.41%), Postives = 141/184 (76.63%), Query Frame = 1
Query:   79 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            M ++PE EHP   FGW ARD SGVLSPFHFSRR  GE DVT K+  CG+CH+DLH IKN+WG + YP+VPGHEIVG+ T+VG  V+KFK GD+VGVG + GSC+SC+SC  DLENYCP++  TY +   DGT  YGGYS+ +V D+ FV+R PE  P D+ APLLCAGITVYS +++YG+ + G
Sbjct:    1 MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMTEAG 184          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH3_STYHU (Probable mannitol dehydrogenase 3 OS=Stylosanthes humilis GN=CAD3 PE=2 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 7.454e-68
Identity = 119/181 (65.75%), Postives = 146/181 (80.66%), Query Frame = 1
Query:   94 EQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDAT-APLLCAGITVYSLLRFYGLDKPGM 633
            E EHP+ AFGWAARD+SG+LSPF+FSRR  GE+DV  +V +CGICH+DLH+ KN++GN+IYP VPGHE++G+V EVGSKV K+KVGDKVGVG  V SCRSC +C  +LENYCPK I+T   K+ DGT TYGGYSD+MV DEHFV RIPEG PLD   +  LC G + +S L++YGLDKPG+
Sbjct:    7 EFEHPRKAFGWAARDSSGLLSPFNFSRRDIGEEDVALEVLYCGICHTDLHMAKNDFGNSIYPYVPGHEVIGIVAEVGSKVEKYKVGDKVGVGYFVESCRSCQNCIDNLENYCPKHILTQGDKHIDGTTTYGGYSDSMVVDEHFVTRIPEGLPLDGCGSSSLCWGYS-HSPLKYYGLDKPGL 186          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: MTDH_MEDSA (Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.832e-67
Identity = 115/184 (62.50%), Postives = 143/184 (77.72%), Query Frame = 1
Query:   79 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKPG 630
            M ++PE E P  AFGWAARDTSG LSPFHFSRR  G+ DV+ K+ +CG+CHSDLH +KN+WG   YP+VPGHEIVGVVT+VG  V KF+VGD VGVG +V SC++C++C  DLE YCPK + TY S Y  GT TYGGYSD +V  + +VV+ P+  PLDA APLLCAGITVYS +++YG+ +PG
Sbjct:    1 MAKSPETELPLKAFGWAARDTSGTLSPFHFSRRENGDDDVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGINVKKFRVGDNVGVGVIVESCQTCENCNQDLEQYCPKPVFTYNSPY-KGTRTYGGYSDFVVVHQRYVVQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTEPG 183          
BLAST of FC876326 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.090e-66
Identity = 113/178 (63.48%), Postives = 141/178 (79.21%), Query Frame = 1
Query:   94 EQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSLLRFYGLDKP 627
            E+E    AFGWAARD+SG LSPF FSRR TGE++V  KV +CGICHSDLH +KNEW ++IYP+VPGHEI+G V+E+G+KVSKF +GDKVGVGC+V SCR+C+SC  D ENYC K I TY   +HDGTI YGGYSD +V DE + V+IP   PL + APLLCAGI++YS ++++GL  P
Sbjct:    7 EKEQSVEAFGWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGNKVSKFNLGDKVGVGCIVDSCRTCESCREDQENYCTKAIATYNGVHHDGTINYGGYSDHIVVDERYAVKIPHTLPLVSAAPLLCAGISMYSPMKYFGLTGP 184          
The following BLAST results are available for this feature:
BLAST of FC876326 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
MTDH_MESCR1.266e-8376.92Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
MTDH_FRAAN1.399e-8276.37Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
GEDH1_OCIBA2.312e-7770.27Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
MTDH_APIGR4.820e-7570.11Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
CADH8_ARATH2.392e-7472.57Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]
CADH7_ARATH5.162e-6969.14Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis th... [more]
CADH9_ARATH5.707e-6861.41Probable cinnamyl alcohol dehydrogenase 9 OS=Arabi... [more]
MTDH3_STYHU7.454e-6865.75Probable mannitol dehydrogenase 3 OS=Stylosanthes ... [more]
MTDH_MEDSA2.832e-6762.50Probable mannitol dehydrogenase OS=Medicago sativa... [more]
CADH6_ARATH4.090e-6663.48Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D08EF DevOvary1 Citrus clementina cDNA clone C32003D08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876326 ID=FC876326|Name=FC876326|organism=Citrus clementina|type=EST|length=696bp
GATTGCACCTTGTTTATTCAAATACCCTGGACGTCAAACTAAGCCAACAA
GCACCAATATCATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAG
AGCACCCTAAGAACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTT
CTCTCCCCCTTTCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGAC
ATTCAAAGTAACTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCA
AAAATGAATGGGGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATT
GTGGGCGTAGTGACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGG
AGACAAAGTGGGAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATA
GCTGCGCCATTGATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTAT
GCCAGCAAGTACCATGATGGAACCATCACATACGGAGGCTACTCTGACAC
TATGGTTGCCGATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCAC
TTGACGCCACTGCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCTG
TTGAGATTCTATGGACTCGACAAGCCTGGTATGCATGTGGGTGTTGTCGG
CTTGGGCGGTCTAGGCCATGTCGCTGTCAAATCGCAAGGCTATGGG
back to top