FC876328

Overview
NameFC876328
Unique NameFC876328
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length604
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10302 contig Ccv1_Contig10302:1..604. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.617e-57
Identity = 101/147 (68.71%), Postives = 117/147 (79.59%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAXRLNLCVVN 602
            PPGPKPWPI+GNL HLGP PHQS A +A+T+GPLMYL++GF             QFLK HD+NFS+RPPNSGA+H+AYNYQD+VF PYGPRWRMLRKI SVHLFS KALDD+RHVRQ+E+  LTRALASAG +PV L   LN+C  N
Sbjct:   34 PPGPKPWPIIGNLVHLGPKPHQSTAAMAQTYGPLMYLKMGFVDVVVAASASVAAQFLKTHDANFSSRPPNSGAEHMAYNYQDLVFAPYGPRWRMLRKICSVHLFSTKALDDFRHVRQDEVKTLTRALASAGQKPVKLGQLLNVCTTN 180          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 2.708e-54
Identity = 92/147 (62.59%), Postives = 116/147 (78.91%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPVNLAXRLNLCVVN 602
            PPGP PWPI+GNLPH+G  PH++++ +  T+GP+++LRLGF             QFLKIHD+NF++RPPNSGAKH+AYNYQD+VF PYG RWR+LRKISSVHLFS KAL+D++HVRQEE+  LTR L   GT+PVNL   +N+CVVN
Sbjct:   34 PPGPNPWPIIGNLPHMGTKPHRTLSAMVTTYGPILHLRLGFVDVVVAASKSVAEQFLKIHDANFASRPPNSGAKHMAYNYQDLVFAPYGHRWRLLRKISSVHLFSAKALEDFKHVRQEEVGTLTRELVRVGTKPVNLGQLVNMCVVN 180          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.816e-35
Identity = 68/149 (45.64%), Postives = 98/149 (65.77%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLAXRLNLCVVN 602
            PPGP  WP++G LP LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL  +  VR++E+  +  A+A +G   +PV ++  L   + N
Sbjct:   38 PPGPIGWPVLGALPLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMAN 186          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 8.193e-35
Identity = 68/149 (45.64%), Postives = 100/149 (67.11%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAXRLNLCVVN 602
            PPGP+ WP++G LP LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF PYGPRW++LRK+S++H+  GKAL+++ +VR  E+  + +++  AS   E + +A  L   + N
Sbjct:   37 PPGPEGWPVIGALPLLGGMPHVALAKMAKKYGPIMYLKVGTCGMVVASTPNAAKAFLKTLDINFSNRPPNAGATHMAYNAQDMVFAPYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDASHVGERIVVADMLTFAMAN 185          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 3.113e-34
Identity = 67/149 (44.97%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGT--EPVNLAXRLNLCVVN 602
            PPGP  WP++G L  LG MPH ++A +A+ +GP+MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL  +  VR++E+  +  A+A +G   +PV ++  L   + N
Sbjct:   38 PPGPIGWPVLGALRLLGTMPHVALANMAKKYGPVMYLKVGSCGLAVASTPEAAKAFLKTLDMNFSNRPPNAGATHLAYNAQDMVFADYGPRWKLLRKLSNIHILGGKALQGWEEVRKKELGYMLYAMAESGRHGQPVVVSEMLTYAMAN 186          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A4_GENTR (Flavonoid 3',5'-hydroxylase OS=Gentiana triflora GN=CYP75A4 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 6.936e-34
Identity = 67/149 (44.97%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAXRLNLCVVN 602
            PPGP  WPI+G LP LG MPH + A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGP+W++LRK+S++H+  GKAL+++  VR+ E+  + +A+  +S   EPV ++  L   + N
Sbjct:   42 PPGPTGWPILGALPLLGNMPHVTFANMAKKYGSVMYLKVGSHGLAIASTPDAAKAFLKTLDLNFSNRPPNAGATHLAYNAQDMVFAHYGPKWKLLRKLSNLHMLGGKALENWADVRKTELGYMLKAMFESSQNNEPVMISEMLTYAMAN 190          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.018e-33
Identity = 62/133 (46.62%), Postives = 91/133 (68.42%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTE 560
            PPGP+ WP++G LP LG MPH S+A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AYN QD+VF  YGPRW++LRK+S++H+  GKAL+++ +VR  E+  + ++++    E
Sbjct:   34 PPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMAVASTPDAAKAFLKTLDINFSNRPPNAGATHLAYNAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMSDMSRE 166          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.308e-32
Identity = 66/149 (44.30%), Postives = 96/149 (64.43%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL--ASAGTEPVNLAXRLNLCVVN 602
            PPGP+ WP++G LP LG MPH S+A +A+ +G +MYL++G               FLK  D NFSNRPPN+GA H+AY  QD+VF  YGPRW++LRK+S++H+  GKAL+++ +VR  E+  + +++   S   E V +A  L   + N
Sbjct:   34 PPGPRGWPVIGALPLLGAMPHVSLAKMAKKYGAIMYLKVGTCGMVVASTPDAAKAFLKTLDLNFSNRPPNAGATHLAYGAQDMVFAHYGPRWKLLRKLSNLHMLGGKALENWANVRANELGHMLKSMFDMSREGERVVVAEMLTFAMAN 182          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 1.889e-31
Identity = 61/135 (45.19%), Postives = 87/135 (64.44%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRALASAGTEPV 566
            PPGP  WPI+G LP LG MPH S+A +A  +GP+MYL+LG               FLK HD+NFSNRP + G  ++AYN QD+VF  YGP+W++LRK+ S+H+   KAL+D+ HV+  E+  + + +    ++ V
Sbjct:   39 PPGPTGWPIIGALPLLGTMPHVSLADMAVKYGPIMYLKLGSKGTVVASNPKAARAFLKTHDANFSNRPIDGGPTYLAYNAQDMVFAEYGPKWKLLRKLCSLHMLGPKALEDWAHVKVSEVGHMLKEMYEQSSKSV 173          
BLAST of FC876328 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.401e-26
Identity = 54/150 (36.00%), Postives = 87/150 (58.00%), Query Frame = 3
Query:  162 PPGPKPWPIVGNLPHLGPMPHQSIAGLARTHGPLMYLRLGFXXXXXXXXXXXXXQFLKIHDSNFSNRPPNSGAKHIAYNYQDIVFRPYGPRWRMLRKISSVHLFSGKALDDYRHVRQEEMAVLTRAL---ASAGTEPVNLAXRLNLCVVN 602
            PPGP PWPI+GN   +    H+++  LA  +GP+++LR G               FLK HD  F++RPP S  K+  YN++DI F PYG  WR +RKI  + L + K ++ ++HVRQEE++ +  ++   + +G   VN++  ++  + N
Sbjct:   43 PPGPYPWPIIGNFHQVRLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAISTSLAN 192          
The following BLAST results are available for this feature:
BLAST of FC876328 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 116
Match NameE-valueIdentityDescription
F3PH_PETHY2.617e-5768.71Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
F3PH_ARATH2.708e-5462.59Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C75A5_EUSGR2.816e-3545.64Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A2_SOLME8.193e-3545.64Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C75A7_EUSGR3.113e-3444.97Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A4_GENTR6.936e-3444.97Flavonoid 3',5'-hydroxylase OS=Gentiana triflora G... [more]
C75A1_PETHY2.018e-3346.62Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C75A3_PETHY1.308e-3244.30Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C75A6_CAMME1.889e-3145.19Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]
C75A1_PINTA1.401e-2636.00Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D11EF DevOvary1 Citrus clementina cDNA clone C32003D11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876328 ID=FC876328|Name=FC876328|organism=Citrus clementina|type=EST|length=604bp
GGCGACTACTCGTACCATTTCTACACTTTCTCTGGGAAACGAAACAAAGA
GCAATGTCTACTTTACCACTACTGATACTGTACACATCACTTTTGGCAAT
TGTCATTTCTTTCCTTTTTAGCCTCCTCCGGAACAGACGCAGACACTCCT
CCCACCGTCTGCCTCCCGGTCCGAAACCCTGGCCAATAGTCGGAAACCTC
CCTCACTTGGGCCCTATGCCCCACCAATCCATAGCGGGTCTGGCCCGAAC
CCACGGCCCCCTCATGTACCTCCGGTTAGGCTTCGTTGACGTCGTCGTGG
CCGCTTCCGCTTCCGTGGCGGCCCAATTCCTGAAGATCCATGATTCCAAC
TTCTCCAACCGCCCTCCCAACTCCGGCGCCAAGCACATCGCTTACAACTA
TCAGGACATCGTTTTCCGGCCGTACGGCCCCCGCTGGCGGATGCTGAGGA
AGATCAGCTCCGTTCATCTTTTCTCCGGCAAGGCCTTGGATGACTACAGG
CACGTTCGCCAGGAAGAGATGGCGGTGCTCACGCGCGCGTTGGCGAGTGC
AGGAACGGAGCCGGTGAACTTAGCTCNACGGTTGAACTTGTGCGTTGTGA
ATGC
back to top