FC920398

Overview
NameFC920398
Unique NameFC920398
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length663
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14268 contig Ccv1_Contig14268:4..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKY_TOBAC (Phosphoglycerate kinase, cytosolic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.136e-90
Identity = 166/188 (88.30%), Postives = 178/188 (94.68%), Query Frame = 3
Query:   99 MAAKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            MA KKSV  LKEADLKGKRVFVRVDLNVPLD+N NITDD R+RAAVPTIKYLM HG+ VIL+SHLGRPKGVTPKYSLKPLVPRLSELLGVEVK+AND IG EVEK+VAEIPEGGVLLLENVRF+KEEEKN+PEFAKKLASLADLYVNDAFG+AHRAHASTEGVAK+LKP+VAGFLM KELDYLVGAV+
Sbjct:    1 MAVKKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHGSHVILASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVAKYLKPAVAGFLMQKELDYLVGAVA 188          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_TOBAC (Phosphoglycerate kinase, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 3.911e-84
Identity = 156/186 (83.87%), Postives = 169/186 (90.86%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            AKKSV  L  A+LKGK+VFVR DLNVPLDDN NITDD R+RAAVPTIK+LM +GAKVILSSHLGRPKGVTPKYSL PLVPRLSELLG++V    DCIG EVEK+VA +PEGGVLLLENVRF+KEEEKN+PEFAKKLASLADLYVNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYLVGAVS
Sbjct:   77 AKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLMANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVS 262          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_SPIOL (Phosphoglycerate kinase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=2)

HSP 1 Score: 310.842 bits (795), Expect = 3.911e-84
Identity = 155/186 (83.33%), Postives = 172/186 (92.47%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            AKKSV  L  ADLKGK+VFVR DLNVPLDD+ NITDD R+RAA+PTIK+L+ +GAKVILSSHLGRPKGVTPK+SL PLVPRLSELLG++V  A+DCIG +VEK+VAE+PEGGVLLLENVRF+KEEEKNDPEFAKKLASLADLYVNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYLVGAVS
Sbjct:   30 AKKSVGDLTSADLKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLINNGAKVILSSHLGRPKGVTPKFSLAPLVPRLSELLGLQVVKADDCIGPDVEKLVAELPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVS 215          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKY_WHEAT (Phosphoglycerate kinase, cytosolic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 5.647e-83
Identity = 153/188 (81.38%), Postives = 170/188 (90.43%), Query Frame = 3
Query:   99 MAAKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            MA K+SV  L EADLKGK+VFVR DLNVPLDD   ITDD R+RA++PTIKYL+  GAKVIL+SHLGRPKGVTPK+SLKPLV RLSELLG+EV MA DCIGEEVEK+ A +P+GGVLLLENVRF+KEEEKNDPEFAKKLAS+ADLYVNDAFG+AHRAHASTEGV KFL+PSVAGFLM KELDYLVGAV+
Sbjct:    1 MATKRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILASHLGRPKGVTPKFSLKPLVARLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLENVRFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHASTEGVTKFLRPSVAGFLMQKELDYLVGAVA 188          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_ARATH (Phosphoglycerate kinase, chloroplastic OS=Arabidopsis thaliana GN=At1g56190 PE=1 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 9.633e-83
Identity = 152/186 (81.72%), Postives = 169/186 (90.86%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            AKKSV  L   DLKGK+VFVR DLNVPLDDN NITDD R+RAA+PTIK+L+ +GAKVILS+HLGRPKGVTPK+SL PLVPRLSELLG+EV  A+DCIG EVE +VA +PEGGVLLLENVRF+KEEEKN+P+FAKKLASLADLYVNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYLVGAVS
Sbjct:   75 AKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLVGAVS 260          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_WHEAT (Phosphoglycerate kinase, chloroplastic OS=Triticum aestivum PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 9.016e-81
Identity = 151/186 (81.18%), Postives = 166/186 (89.25%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            AKKSV  L  ADL+GKRV VR DLNVPLDDN NITDD R+RAA+PTIKYL+ +GAKVIL+SHLGRPKGVTPK+SL PLVPRLSELLG+EVK A D IG EVEK+VA++  G VLLLENVRF+KEEEKNDPEFAKKLASLADL+VNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYL GAVS
Sbjct:   74 AKKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVILTSHLGRPKGVTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENVRFYKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLDGAVS 259          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_VOLCA (Phosphoglycerate kinase, chloroplastic OS=Volvox carteri GN=PGK PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.443e-70
Identity = 141/189 (74.60%), Postives = 157/189 (83.07%), Query Frame = 3
Query:  102 AAKKSVSVLKEADLKGKRVFVRVDLNVPLDDN-LNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            A KKSV  L +ADL+GKRVFVR DLNVPLD   L ITDD R+RAAVPT+KYL+ +GAKV+L+SHLGRPKG    KY L P+V RLSELLG EVK  +DCIG  VE+ VA +  G +LLLENVRF+KEEEKNDPEFAKKLAS ADLYVNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYL GAVS
Sbjct:   61 AVKKSVGDLGKADLEGKRVFVRADLNVPLDKKTLAITDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPEDKYRLTPVVARLSELLGKEVKKVDDCIGPSVEQAVASLKSGELLLLENVRFYKEEEKNDPEFAKKLASNADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLDGAVS 249          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGKH_CHLRE (Phosphoglycerate kinase, chloroplastic OS=Chlamydomonas reinhardtii PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 3.008e-68
Identity = 137/189 (72.49%), Postives = 154/189 (81.48%), Query Frame = 3
Query:  102 AAKKSVSVLKEADLKGKRVFVRVDLNVPLDD-NLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKG-VTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAVS 662
            A KKSV  L +ADL+GKRVFVR DLNVPLD   L ITDD R+RAAVPT+KYL+ +GAKV+L+SHLGRPKG    KY L P+V RLSELLG  V   +DCIG EVEK V  +  G +LLLEN RF+KEEEKN+PEFAKKLA+ ADLYVNDAFG+AHRAHASTEGV KFLKPSVAGFL+ KELDYL GAVS
Sbjct:   60 AVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGPEVEKAVGAMKNGELLLLENCRFYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHASTEGVTKFLKPSVAGFLLQKELDYLDGAVS 248          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_ANAVT (Phosphoglycerate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pgk PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.231e-63
Identity = 125/185 (67.57%), Postives = 143/185 (77.30%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +KK+V+ L  AD+ GKR  VRVD NVPLDD  NITDD R+RAA+PTI+ L   GAKVIL+SH GRPKGV  K  L P+  RLSELLG EV   +D IG+EV   VA +  G VLLLENVRF+KEEEKNDPEFAKKLA+ AD YVNDAFG+AHRAHASTEGV KFL PSVAG+L+ KEL YL  A+
Sbjct:    2 SKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDSIGDEVAAKVAALQNGQVLLLENVRFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQSAI 186          
BLAST of FC920398 vs. ExPASy Swiss-Prot
Match: PGK_ANASP (Phosphoglycerate kinase OS=Anabaena sp. (strain PCC 7120) GN=pgk PE=1 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 2.914e-63
Identity = 125/185 (67.57%), Postives = 143/185 (77.30%), Query Frame = 3
Query:  105 AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVRFHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHASTEGVAKFLKPSVAGFLMXKELDYLVGAV 659
            +KK+V+ L  AD+ GKR  VRVD NVPLDD  NITDD R+RAA+PTI+ L   GAKVIL+SH GRPKGV  K  L P+  RLSELLG EV   +D IG+EV   VA +  G VLLLENVRF+KEEEKNDPEFAKKLA+ AD YVNDAFG+AHRAHASTEGV KFL PSVAG+L+ KEL YL  A+
Sbjct:    2 SKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVILASHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVATLQNGQVLLLENVRFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHASTEGVTKFLSPSVAGYLVEKELQYLQSAI 186          
The following BLAST results are available for this feature:
BLAST of FC920398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
PGKY_TOBAC8.136e-9088.30Phosphoglycerate kinase, cytosolic OS=Nicotiana ta... [more]
PGKH_TOBAC3.911e-8483.87Phosphoglycerate kinase, chloroplastic OS=Nicotian... [more]
PGKH_SPIOL3.911e-8483.33Phosphoglycerate kinase, chloroplastic (Fragment) ... [more]
PGKY_WHEAT5.647e-8381.38Phosphoglycerate kinase, cytosolic OS=Triticum aes... [more]
PGKH_ARATH9.633e-8381.72Phosphoglycerate kinase, chloroplastic OS=Arabidop... [more]
PGKH_WHEAT9.016e-8181.18Phosphoglycerate kinase, chloroplastic OS=Triticum... [more]
PGKH_VOLCA1.443e-7074.60Phosphoglycerate kinase, chloroplastic OS=Volvox c... [more]
PGKH_CHLRE3.008e-6872.49Phosphoglycerate kinase, chloroplastic OS=Chlamydo... [more]
PGK_ANAVT2.231e-6367.57Phosphoglycerate kinase OS=Anabaena variabilis (st... [more]
PGK_ANASP2.914e-6367.57Phosphoglycerate kinase OS=Anabaena sp. (strain PC... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007G09EF RVDevelop1 Citrus clementina cDNA clone C32007G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920398 ID=FC920398|Name=FC920398|organism=Citrus clementina|type=EST|length=663bp
GATTTTCTCACTTAGCGTTCACCAATCTTCGATCTCATTCCAAAATCTAA
CCAAAACCCCTTCTCGATTTCTCCGATCTCGTGTTTGATCGAATCAAAAT
GGCCGCCAAGAAGAGTGTAAGCGTTCTAAAAGAAGCTGATTTGAAGGGAA
AGAGAGTGTTCGTACGAGTGGATCTGAACGTGCCGTTGGATGACAACTTG
AATATCACCGATGACAACAGAGTCCGTGCTGCTGTTCCCACTATCAAATA
CCTGATGGGTCATGGCGCCAAAGTCATTCTCTCCAGTCACTTGGGGCGTC
CAAAGGGTGTTACACCCAAGTACAGCTTGAAACCTCTTGTGCCAAGGCTT
TCTGAACTTCTTGGAGTTGAGGTTAAAATGGCAAACGACTGCATTGGTGA
AGAAGTTGAAAAAATGGTGGCTGAAATTCCCGAAGGGGGCGTCTTGCTCC
TCGAAAATGTGAGGTTCCATAAGGAGGAAGAGAAGAATGACCCAGAGTTT
GCTAAGAAGCTAGCTTCTCTTGCAGATCTCTATGTTAATGATGCATTCGG
ATCTGCCCATAGAGCCCATGCTTCCACTGAGGGTGTGGCTAAGTTCTTGA
AGCCTTCTGTGGCTGGTTTCCTTATGNCAAAGGAACTAGATTATCTTGTT
GGAGCTGTTTCAA
back to top