FC920405

Overview
NameFC920405
Unique NameFC920405
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length708
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14135 contig Ccv1_Contig14135:1..708. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_CUCSA (60S ribosomal protein L5 OS=Cucumis sativus GN=RPL5 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 2.608e-92
Identity = 167/201 (83.08%), Postives = 182/201 (90.55%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVAA 707
            KAQK+KAYFKRYQVK+KRRREGKTDYRARIRLINQDKNKYNTPKYRFVVR +NKDITAQIISASIAGD+VLASAY+HELP+YGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEP + RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAG++K+ +QLD EVHRKYI+ G VAA
Sbjct:    5 KAQKTKAYFKRYQVKFKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRTSNKDITAQIISASIAGDLVLASAYSHELPQYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPADTRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGYAKNGQQLDVEVHRKYIFGGHVAA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL52_ARATH (60S ribosomal protein L5-2 OS=Arabidopsis thaliana GN=RPL5B PE=2 SV=3)

HSP 1 Score: 330.872 bits (847), Expect = 4.164e-90
Identity = 162/200 (81.00%), Postives = 178/200 (89.00%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K+ KS AYFKRYQVK++RRR+GKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI AQI+SASIAGDIV ASAYAHELP+YGL VGLTNYAAAYCTGLLLARRVLKMLEMD EYEGNVEATGED+SVEPT++RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAGF K++KQLDAE+HR YIY G V+
Sbjct:    5 KSSKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS 204          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL51_ARATH (60S ribosomal protein L5-1 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=2)

HSP 1 Score: 330.487 bits (846), Expect = 5.438e-90
Identity = 162/200 (81.00%), Postives = 178/200 (89.00%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K+ KS AYFKRYQVK++RRR+GKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDI AQI+SASIAGDIV ASAYAHELP+YGL VGLTNYAAAYCTGLLLARRVLKMLEMD EYEGNVEATGED+SVEPT++RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAGF K++KQLDAE+HR YIY G V+
Sbjct:    5 KSTKSNAYFKRYQVKFRRRRDGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDIVAQIVSASIAGDIVKASAYAHELPQYGLTVGLTNYAAAYCTGLLLARRVLKMLEMDDEYEGNVEATGEDFSVEPTDSRRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFHKENKQLDAEIHRNYIYGGHVS 204          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL51_ORYSI (60S ribosomal protein L5-1 OS=Oryza sativa subsp. indica GN=RPL5A PE=2 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 3.299e-87
Identity = 154/200 (77.00%), Postives = 174/200 (87.00%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K QK+ AY+KR+QVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFVVRFTNKDITAQI+ A+IAGDIV+A+AY+HELPRYGLEVGLTNYAAAYCTGLLLARRVLK+  +D EYEGN+EATGEDY VEP + RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAGF KD KQLD+++HRKYIY G VA
Sbjct:    6 KTQKTNAYYKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL51_ORYSJ (60S ribosomal protein L5-1 OS=Oryza sativa subsp. japonica GN=RPL5A PE=2 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 9.600e-87
Identity = 154/200 (77.00%), Postives = 173/200 (86.50%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K QK+ AY KR+QVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFVVRFTNKDITAQI+ A+IAGDIV+A+AY+HELPRYGLEVGLTNYAAAYCTGLLLARRVLK+  +D EYEGN+EATGEDY VEP + RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAGF KD KQLD+++HRKYIY G VA
Sbjct:    6 KTQKTNAYHKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFVVRFTNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLKLRGLDQEYEGNIEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL52_ORYSJ (60S ribosomal protein L5-2 OS=Oryza sativa subsp. japonica GN=RPL5B PE=3 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 1.695e-83
Identity = 152/200 (76.00%), Postives = 170/200 (85.00%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K QK+ AYFKR+QVK+KRRR+GKTDYRARIRL NQDKNKYNTPKYRFV   TNKDITAQI+ A+IAGDIV+A+AY+HELPRYGLEVGLTNYAAAYCTGLLLARRVL +  +D EYEGNVEATGEDY VEP + RRPFRALLDVGL++TTTGNRVF            IPHS+KRFAGF KD KQLD+++HRKYIY G VA
Sbjct:    9 KTQKTHAYFKRFQVKFKRRRQGKTDYRARIRLTNQDKNKYNTPKYRFV---TNKDITAQIVYATIAGDIVMAAAYSHELPRYGLEVGLTNYAAAYCTGLLLARRVLTLRGLDQEYEGNVEATGEDYYVEPADERRPFRALLDVGLIRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDEKQLDSDIHRKYIYGGHVA 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_SUBDO (60S ribosomal protein L5 OS=Suberites domuncula GN=RPL5 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 7.152e-66
Identity = 127/201 (63.18%), Postives = 150/201 (74.63%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPT-ENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+KAYFKRYQVK++RRREGKTDYRAR RL+ QDKNKYNTPKYR V+RFTN DI  QII A I GD VL SAYAHELPRYG++VGLTNYAAAYCTGLLLARR+L  L +  +Y G  +  GED++VE   +  RPFRA LDVGL +TTTGNRVF            IPHS  RF G+ ++S QL+A+  R+YI+ G V+
Sbjct:    5 KVIKNKAYFKRYQVKFRRRREGKTDYRARKRLVVQDKNKYNTPKYRIVIRFTNTDIICQIIYAKIEGDKVLVSAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTNLGLADKYAGQTDIDGEDFNVEHMGDGPRPFRAFLDVGLTRTTTGNRVFAAMKGAVDGGIDIPHSPSRFVGYDEESSQLEADKLRQYIFGGHVS 205          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_CAEBR (60S ribosomal protein L5 OS=Caenorhabditis briggsae GN=rpl-5 PE=3 SV=2)

HSP 1 Score: 249.98 bits (637), Expect = 9.341e-66
Identity = 124/200 (62.00%), Postives = 149/200 (74.50%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+KAYFKRYQVK KRRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKDI AQ+  + I GD+V+ASAYAHELPRYGL+ GLTNYAAAY TGLLLARR LK + +D+ Y+G+ E TGEDY+VE   +R PF+A+LD+GL +TTTG+++F            +PHSE RF GF ++SK  +AE HR  I    VA
Sbjct:    5 KVIKNKAYFKRYQVKLKRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRLTNKDIVAQLAYSKIEGDVVVASAYAHELPRYGLKAGLTNYAAAYATGLLLARRHLKAIGLDSTYKGHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFFGFDQESKDYNAEAHRDRILGKHVA 204          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_CAEEL (60S ribosomal protein L5 OS=Caenorhabditis elegans GN=rpl-5 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.220e-65
Identity = 122/200 (61.00%), Postives = 151/200 (75.50%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENRRPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+KAYFKRYQVK +RRREGKTDY AR RL  QDKNKYNTPKYR +VR TNKD+ AQ+  + I GD+V+ASAY+HELPRYGL+VGLTNYAAAY TGLLLARR LK + +D+ Y+G+ E TGEDY+VE   +R PF+A+LD+GL +TTTG+++F            +PHSE RF GF ++SK+ +AE HR  I    VA
Sbjct:    5 KVIKNKAYFKRYQVKLRRRREGKTDYYARKRLTVQDKNKYNTPKYRLIVRITNKDVVAQLAYSKIEGDVVVASAYSHELPRYGLKVGLTNYAAAYATGLLLARRHLKTIGLDSTYKGHEELTGEDYNVEEEGDRAPFKAVLDIGLARTTTGSKIFAVMKGVADGGINVPHSESRFFGFDQESKEYNAEAHRDRILGKHVA 204          
BLAST of FC920405 vs. ExPASy Swiss-Prot
Match: RL5_HUMAN (60S ribosomal protein L5 OS=Homo sapiens GN=RPL5 PE=1 SV=3)

HSP 1 Score: 243.432 bits (620), Expect = 8.743e-64
Identity = 121/201 (60.20%), Postives = 147/201 (73.13%), Query Frame = 3
Query:  105 KAQKSKAYFKRYQVKYKRRREGKTDYRARIRLINQDKNKYNTPKYRFVVRFTNKDITAQIISASIAGDIVLASAYAHELPRYGLEVGLTNYAAAYCTGLLLARRVLKMLEMDAEYEGNVEATGEDYSVEPTENR-RPFRALLDVGLVKTTTGNRVFXXXXXXXXXXXXIPHSEKRFAGFSKDSKQLDAEVHRKYIYCGRVA 704
            K  K+KAYFKRYQVK++RRREGKTDY AR RL+ QDKNKYNTPKYR +VR TN+DI  QI  A I GD+++ +AYAHELP+YG++VGLTNYAAAYCTGLLLARR+L    MD  YEG VE TG++Y+VE  + +   F   LD GL +TTTGN+VF            IPHS KRF G+  +SK+ +AEVHRK+I    VA
Sbjct:    5 KVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVA 205          
The following BLAST results are available for this feature:
BLAST of FC920405 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
RL5_CUCSA2.608e-9283.0860S ribosomal protein L5 OS=Cucumis sativus GN=RPL... [more]
RL52_ARATH4.164e-9081.0060S ribosomal protein L5-2 OS=Arabidopsis thaliana... [more]
RL51_ARATH5.438e-9081.0060S ribosomal protein L5-1 OS=Arabidopsis thaliana... [more]
RL51_ORYSI3.299e-8777.0060S ribosomal protein L5-1 OS=Oryza sativa subsp. ... [more]
RL51_ORYSJ9.600e-8777.0060S ribosomal protein L5-1 OS=Oryza sativa subsp. ... [more]
RL52_ORYSJ1.695e-8376.0060S ribosomal protein L5-2 OS=Oryza sativa subsp. ... [more]
RL5_SUBDO7.152e-6663.1860S ribosomal protein L5 OS=Suberites domuncula GN... [more]
RL5_CAEBR9.341e-6662.0060S ribosomal protein L5 OS=Caenorhabditis briggsa... [more]
RL5_CAEEL1.220e-6561.0060S ribosomal protein L5 OS=Caenorhabditis elegans... [more]
RL5_HUMAN8.743e-6460.2060S ribosomal protein L5 OS=Homo sapiens GN=RPL5 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H05EF RVDevelop1 Citrus clementina cDNA clone C32007H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920405 ID=FC920405|Name=FC920405|organism=Citrus clementina|type=EST|length=708bp
GGAGCGTGTTAGGGTTTAAGTACATTGGATTTAGCTCGCGGCTCCTTCAC
AACTTCTCGAACTCTGCTGCTTCTACACTTTGAGCTTCAGCAATGGCCTT
TGCCAAAGCTCAAAAGTCAAAAGCTTACTTTAAGCGATATCAAGTTAAGT
ACAAGAGAAGGCGAGAGGGAAAGACTGACTATCGGGCTAGGATTCGCCTG
ATCAACCAAGATAAAAACAAGTACAACACGCCAAAGTATCGGTTTGTTGT
GCGATTCACCAACAAAGATATCACTGCACAAATTATATCTGCCAGCATAG
CCGGGGATATAGTCCTTGCATCTGCTTATGCCCATGAGCTTCCCCGTTAT
GGTCTTGAGGTGGGCCTCACTAATTATGCAGCAGCTTATTGCACTGGACT
CCTCTTGGCCCGCCGAGTCCTGAAAATGCTTGAGATGGATGCTGAGTATG
AGGGGAACGTTGAGGCAACAGGAGAGGACTATTCAGTTGAGCCAACTGAG
AACAGGAGGCCTTTCCGTGCCCTGCTTGATGTTGGTCTTGTGAAAACAAC
TACTGGTAACCGTGTCTTTGGCGCTCTTAAGGGTGCATTGGATGGTGGAC
TTGATATCCCTCACAGTGAGAAGAGATTTGCTGGATTCAGTAAGGATAGT
AAGCAACTTGACGCTGAAGTTCACCGTAAATACATCTATTGTGGTCGTGT
CGCTGCCT
back to top