FC920406

Overview
NameFC920406
Unique NameFC920406
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length699
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15182 contig Ccv1_Contig15182:23..721. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 3.136e-90
Identity = 162/204 (79.41%), Postives = 174/204 (85.29%), Query Frame = 1
Query:   88 MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            MV+S T + S   + STFASRYVR ++PRFKMPDNS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ D +TAVGVGTVGSSEAIMLAGLAFKRKWQ K K QGKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P K+ E VDENTI
Sbjct:    1 MVLSKTVSQSDVSIHSTFASRYVRTSLPRFKMPDNSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPEKAVEMVDENTI 204          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 5.349e-90
Identity = 159/205 (77.56%), Postives = 176/205 (85.85%), Query Frame = 1
Query:   88 MVISTTET-DSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            MV++TT   DS E L  TFASRYV+  +P+FKMP  SMPKEAAYQ++NDELMLDGNPRLNLASFV+TWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNM+AHLF+ PV DD+TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP+DKPNIVTGANVQVCWEKFARYF           GYYVM+P K+ E VDENTI
Sbjct:    1 MVLTTTSIRDSEESLHCTFASRYVQEPLPKFKMPKKSMPKEAAYQIVNDELMLDGNPRLNLASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAVGVGTVGSSEAIMLAGLAFKRKWQSKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKEVKLKEGYYVMDPAKAVEIVDENTI 205          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 326.635 bits (836), Expect = 7.724e-89
Identity = 157/204 (76.96%), Postives = 176/204 (86.27%), Query Frame = 1
Query:   88 MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            MV+S   ++S   + STFASRYVR ++PRFKMP+NS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P ++ + VDENTI
Sbjct:    1 MVLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTI 204          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 9.771e-84
Identity = 149/204 (73.04%), Postives = 171/204 (83.82%), Query Frame = 1
Query:   88 MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            MV++ T T+  E + + F SRYVR  +P++++ +NS+PK+AAYQ+I DELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVN+IA LFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKPYDKPNIVTGANVQVCWEKFARYF           GYYVM+P K+ E VDENTI
Sbjct:    1 MVLTKTATND-ESVCTMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLSEGYYVMDPDKAAEMVDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEB_SHIFL (Glutamate decarboxylase beta OS=Shigella flexneri GN=gadB PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEB_ECOLI (Glutamate decarboxylase beta OS=Escherichia coli (strain K12) GN=gadB PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEB_ECO57 (Glutamate decarboxylase beta OS=Escherichia coli O157:H7 GN=gadB PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEA_SHIFL (Glutamate decarboxylase alpha OS=Shigella flexneri GN=gadA PE=2 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEA_ECOLI (Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) GN=gadA PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
BLAST of FC920406 vs. ExPASy Swiss-Prot
Match: DCEA_ECOL6 (Glutamate decarboxylase alpha OS=Escherichia coli O6 GN=gadA PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.427e-42
Identity = 88/198 (44.44%), Postives = 121/198 (61.11%), Query Frame = 1
Query:  109 TDSR-EILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKSCEXVDENTI 699
            TD R E+L S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P +  E  DENTI
Sbjct:    7 TDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTI 203          
The following BLAST results are available for this feature:
BLAST of FC920406 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DCE_PETHY3.136e-9079.41Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE_SOLLC5.349e-9077.56Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE1_ARATH7.724e-8976.96Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE2_ARATH9.771e-8473.04Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
DCEB_SHIFL1.427e-4244.44Glutamate decarboxylase beta OS=Shigella flexneri ... [more]
DCEB_ECOLI1.427e-4244.44Glutamate decarboxylase beta OS=Escherichia coli (... [more]
DCEB_ECO571.427e-4244.44Glutamate decarboxylase beta OS=Escherichia coli O... [more]
DCEA_SHIFL1.427e-4244.44Glutamate decarboxylase alpha OS=Shigella flexneri... [more]
DCEA_ECOLI1.427e-4244.44Glutamate decarboxylase alpha OS=Escherichia coli ... [more]
DCEA_ECOL61.427e-4244.44Glutamate decarboxylase alpha OS=Escherichia coli ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H06EF RVDevelop1 Citrus clementina cDNA clone C32007H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920406 ID=FC920406|Name=FC920406|organism=Citrus clementina|type=EST|length=699bp
GGCTCTCTTTCCTTTGTGTCTCAACAATTTCTATTCATTTCTCTCAGACT
CAAGAGCCTCTCTTCTCTGCAAAAAACAAAAACAAAAATGGTGATTTCAA
CAACAGAAACAGACTCCAGGGAGATTTTGAGCTCCACATTTGCTTCAAGA
TATGTCCGTGCTGCTATTCCCAGATTCAAGATGCCAGATAATTCAATGCC
AAAGGAGGCAGCCTATCAGGTAATAAATGATGAGCTGATGTTAGATGGAA
ATCCAAGGCTGAACTTGGCATCTTTTGTGACCACTTGGATGGAGCCCGAG
TGTGATAAGCTTGTCATGGCTTCGATTAATAAAAACTATGTTGACATGGA
TGAATACCCTGTAACCACAGAGCTCCAGAATCGGTGTGTGAATATGATTG
CCCACCTATTTAATACTCCAGTTGCGGATGACAAGACTGCAGTGGGCGTG
GGGACTGTAGGTTCATCAGAGGCAATAATGCTTGCTGGCTTGGCTTTTAA
AAGGAAGTGGCAGCAGAAGAGAAAAGAGCAAGGCAAACCCTATGATAAGC
CCAATATAGTCACTGGAGCTAATGTGCAGGTATGCTGGGAGAAATTTGCG
AGGTACTTTGAGGTTGAGCTGAAGGAGGTGAAACTGGAAGAGGGATATTA
TGTGATGAATCCTGTGAAAAGCTGTGAGNTGGTAGATGAGAACACCATT
back to top