FC920407

Overview
NameFC920407
Unique NameFC920407
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length677
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8317 contig Ccv1_Contig8317:4..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: AFC3_ARATH (Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2)

HSP 1 Score: 239.195 bits (609), Expect = 1.514e-62
Identity = 114/160 (71.25%), Postives = 136/160 (85.00%), Query Frame = 1
Query:  193 MEQERTTKRRRLAWDVAPSEAEAQRALVVGHEGATAAAAKHVSPPRRDDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRN 672
            M++ER  KR R+ WD AP+E EA+RA++ GH     +  + +SPP RDDDR+GHYVF+L +NLTPRYKILSKMGEGTFGRVLECWDR T+E VAIK++RSI+KYRDAAMIEIDVLQ L K+DK G + CVQ++NWFDYRNHICIVFEKLGPSLF+FLKRN
Sbjct:    9 MDKERVRKRPRMTWDEAPAEPEAKRAVIKGH----GSDGRILSPPLRDDDRDGHYVFSLRDNLTPRYKILSKMGEGTFGRVLECWDRDTKEYVAIKIIRSIKKYRDAAMIEIDVLQKLVKSDK-GRTRCVQMKNWFDYRNHICIVFEKLGPSLFDFLKRN 163          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: AFC2_ARATH (Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 9.835e-54
Identity = 102/176 (57.95%), Postives = 129/176 (73.30%), Query Frame = 1
Query:  205 RTTKRRRLAWDVAPSEAEAQRALVVGHE----------GATA---------AAAKHVSPPRRDDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            R  KR RL WDV P   +AQ  +  G E          GA +           A++ SPP R+DD++GHY+F LG++LTPRYKI SKMGEGTFG+VLECWDR+ +E VA+K+VR ++KYR+AAMIEI++LQ L K+DKGG + CVQIRNWFDYRNHICIVFEKLG SL++FL++NN
Sbjct:   17 RPRKRARLGWDVLPQATKAQVGMFCGQEIGNISSFASSGAPSDNSSSLCVKGVARNGSPPWREDDKDGHYIFELGDDLTPRYKIYSKMGEGTFGQVLECWDRERKEMVAVKIVRGVKKYREAAMIEIEMLQQLGKHDKGG-NRCVQIRNWFDYRNHICIVFEKLGSSLYDFLRKNN 191          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: AFC1_ARATH (Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 5.051e-50
Identity = 109/207 (52.66%), Postives = 133/207 (64.25%), Query Frame = 1
Query:  115 SKLLRSFVLQILRLKIIQRNNK*QTMMEQERTTKRRRLAWDVAPS-------EAEAQRALVVGHEGATAAAAKHV-------------SPPRRDDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            S + R     I  +   QRN +    +  +R  KR RL WD AP            Q  L  G E A+      V             SPP R DD++GHYVF +G+ LTPRY+ILSKMGEGTFG+VLEC+D + +E VAIKV+RSI KYR+AAMIEIDVLQ L ++D GG S CVQIRNWFDYRNHICIVFEKLGPSL++FL++N+
Sbjct:    3 SSVYRDKASSIAMILETQRNVEFPHRIVDKRPRKRPRLTWDAAPPLLPPPPPPTVFQPPLYYGPEFASGLVPNFVYPNMFYNGLPRQGSPPWRPDDKDGHYVFVVGDTLTPRYQILSKMGEGTFGQVLECFDNKNKEVVAIKVIRSINKYREAAMIEIDVLQRLTRHDVGG-SRCVQIRNWFDYRNHICIVFEKLGPSLYDFLRKNS 208          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK2_HUMAN (Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 3.186e-28
Identity = 56/115 (48.70%), Postives = 86/115 (74.78%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWD-RQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD EGH ++++G+ L  RY+I+S +GEGTFGRV++C D R+   RVA+K+++++ KY++AA +EI+VL+ + + D    + CVQ+ +WFDY  H+CI FE LG S F+FLK NN
Sbjct:  144 EDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNN 258          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK2_MOUSE (Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 2.697e-27
Identity = 55/115 (47.83%), Postives = 85/115 (73.91%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWD-RQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD EGH ++++G+ L  RY+I+S +GEGT GRV++C D R+   RVA+K+++++ KY++AA +EI+VL+ + + D    + CVQ+ +WFDY  H+CI FE LG S F+FLK NN
Sbjct:  143 EDDAEGHLIYHVGDWLQERYEIVSTLGEGTSGRVVQCVDHRRGGTRVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNN 257          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: LKH1_SCHPO (Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe GN=lkh1 PE=1 SV=3)

HSP 1 Score: 121.709 bits (304), Expect = 3.522e-27
Identity = 64/154 (41.56%), Postives = 90/154 (58.44%), Query Frame = 1
Query:  214 KRRRLAWDVAPSEAEAQRALVVGHEGATAAAAKHVSPPRRDDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDRQTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            KR+R AW   P   +  R  V      TA        P   DD +GHY          RY ++  +G GTFG+V++C+D+ T    AIKV R+I KYR+A++IE+ VLQ +A +D    + C+Q+R++FDYR HICIV +  G S+F+FLK NN
Sbjct:  312 KRKRAAW---PPYKKVDRVNVPVVHDTTAF------DPSTFDDDDGHYKVVPNSKFANRYTVVRLLGHGTFGKVIQCYDQSTGRHCAIKVTRAIPKYREASLIELRVLQTIAHSDPTNENKCIQLRDYFDYRKHICIVTDLFGWSVFDFLKNNN 456          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK3_RAT (Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.600e-27
Identity = 54/115 (46.96%), Postives = 83/115 (72.17%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD+EGH V  +G+ L  RY+I+  +GEGTFG+V+EC D  + + +VA+K++R++ KYR+AA +EI+VL+ + + DK     CV + +WF++  H+CI FE LG + FEFLK NN
Sbjct:  137 EDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENN 251          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK3_MOUSE (Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.600e-27
Identity = 54/115 (46.96%), Postives = 83/115 (72.17%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD+EGH V  +G+ L  RY+I+  +GEGTFG+V+EC D  + + +VA+K++R++ KYR+AA +EI+VL+ + + DK     CV + +WF++  H+CI FE LG + FEFLK NN
Sbjct:  285 EDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENN 399          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK3_HUMAN (Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 4.600e-27
Identity = 54/115 (46.96%), Postives = 83/115 (72.17%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD+EGH V  +G+ L  RY+I+  +GEGTFG+V+EC D  + + +VA+K++R++ KYR+AA +EI+VL+ + + DK     CV + +WF++  H+CI FE LG + FEFLK NN
Sbjct:  285 EDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENN 399          
BLAST of FC920407 vs. ExPASy Swiss-Prot
Match: CLK3_BOVIN (Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.600e-27
Identity = 54/115 (46.96%), Postives = 83/115 (72.17%), Query Frame = 1
Query:  334 DDDREGHYVFNLGENLTPRYKILSKMGEGTFGRVLECWDR-QTQERVAIKVVRSIRKYRDAAMIEIDVLQHLAKNDKGGSSHCVQIRNWFDYRNHICIVFEKLGPSLFEFLKRNN 675
            +DD+EGH V  +G+ L  RY+I+  +GEGTFG+V+EC D  + + +VA+K++R++ KYR+AA +EI+VL+ + + DK     CV + +WF++  H+CI FE LG + FEFLK NN
Sbjct:  137 EDDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENN 251          
The following BLAST results are available for this feature:
BLAST of FC920407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 68
Match NameE-valueIdentityDescription
AFC3_ARATH1.514e-6271.25Serine/threonine-protein kinase AFC3 OS=Arabidopsi... [more]
AFC2_ARATH9.835e-5457.95Serine/threonine-protein kinase AFC2 OS=Arabidopsi... [more]
AFC1_ARATH5.051e-5052.66Serine/threonine-protein kinase AFC1 OS=Arabidopsi... [more]
CLK2_HUMAN3.186e-2848.70Dual specificity protein kinase CLK2 OS=Homo sapie... [more]
CLK2_MOUSE2.697e-2747.83Dual specificity protein kinase CLK2 OS=Mus muscul... [more]
LKH1_SCHPO3.522e-2741.56Dual specificity protein kinase lkh1 OS=Schizosacc... [more]
CLK3_RAT4.600e-2746.96Dual specificity protein kinase CLK3 OS=Rattus nor... [more]
CLK3_MOUSE4.600e-2746.96Dual specificity protein kinase CLK3 OS=Mus muscul... [more]
CLK3_HUMAN4.600e-2746.96Dual specificity protein kinase CLK3 OS=Homo sapie... [more]
CLK3_BOVIN4.600e-2746.96Dual specificity protein kinase CLK3 OS=Bos taurus... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007H08EF RVDevelop1 Citrus clementina cDNA clone C32007H08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920407 ID=FC920407|Name=FC920407|organism=Citrus clementina|type=EST|length=677bp
ATCGTCACATTCGCCCAAAATATTCCCCCAATGCATAGGAACCCTAATTT
CCGAATGCTACCGTCATATCATCTCTCGCACTCTTATAATTCTGTTCGAA
TTTTCTACTAATATTCAAAACTATTGAGGAGTTTTGTGCTGCAGATACTT
AGGTTAAAAATCATACAAAGGAATAATAAATAGCAAACGATGATGGAGCA
GGAGCGAACCACTAAACGACGTCGGCTCGCTTGGGACGTGGCGCCATCGG
AGGCAGAGGCGCAACGGGCTCTGGTGGTGGGCCATGAAGGGGCTACGGCG
GCGGCTGCAAAACACGTGTCGCCGCCGAGAAGGGACGATGATCGTGAGGG
ACATTACGTTTTTAATCTCGGCGAAAATCTCACCCCCAGATATAAAATAC
TTAGCAAAATGGGTGAAGGCACATTTGGCCGTGTTTTGGAATGTTGGGAC
CGTCAAACACAGGAGCGTGTGGCAATCAAGGTAGTCAGAAGTATACGCAA
GTACCGTGATGCTGCAATGATTGAAATCGATGTTCTTCAGCATCTTGCTA
AAAATGACAAAGGCGGCAGCTCACATTGTGTGCAGATTCGAAATTGGTTT
GATTATCGCAATCATATTTGTATTGTGTTTGAGAAGCTTGGACCAAGTTT
ATTTGAATTTCTAAAGAGAAATAATAC
back to top