FC920408

Overview
NameFC920408
Unique NameFC920408
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920408_ssr449 microsatellite FC920408_ssr449:449..458. BLAST: Citrus ESTs to Prunus persica proteins V1
FC920408_ssr421 microsatellite FC920408_ssr421:421..435. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig13960 contig Ccv1_Contig13960:1..679. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920408 vs. ExPASy Swiss-Prot
Match: WRK11_ARATH (Probable WRKY transcription factor 11 OS=Arabidopsis thaliana GN=WRKY11 PE=1 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 1.222e-30
Identity = 83/182 (45.60%), Postives = 98/182 (53.85%), Query Frame = 1
Query:  148 MAVELMGFPKRMMEDQTAIQEAATQGIKSMEHLIRLMSHHQSSNH-VDCSDLTDLTVSKFKKVISLLNRTGHARFRRGPVHXXXXXXXXXXXXXXXXXGNSPHXXXXXXXXXXXXXXXXXXXXSYVQSQPHSLTLDFTKPSLFSGNVKSTELEXXXXXXXXXXXXXXXXXAITRRRSVSNGK 690
            MAV+LM FPK  ++DQTAIQEAA+QG++SMEHLIR++S+     H VDCS++TD TVSKFK VISLLNRTGHARFRRGPVH                                            +   P S+TLDF+KPS+F    KS ELE                 AIT   SVSNGK
Sbjct:    1 MAVDLMRFPK--IDDQTAIQEAASQGLQSMEHLIRVLSNRPEQQHNVDCSEITDFTVSKFKTVISLLNRTGHARFRRGPVH-----------STSSAASQKLQSQIVKNTQPEAPIVRTTTNHPQIVPPPSSVTLDFSKPSIFGTKAKSAELEFSKENFSVSLNSSFMSSAITGDGSVSNGK 169          
BLAST of FC920408 vs. ExPASy Swiss-Prot
Match: WRK17_ARATH (Probable WRKY transcription factor 17 OS=Arabidopsis thaliana GN=WRKY17 PE=1 SV=2)

HSP 1 Score: 132.88 bits (333), Expect = 1.596e-30
Identity = 82/181 (45.30%), Postives = 101/181 (55.80%), Query Frame = 1
Query:  148 MAVELMGFPKRMMEDQTAIQEAATQGIKSMEHLIRLMSHHQSSNHVDCSDLTDLTVSKFKKVISLLNRTGHARFRRGPVHXXXXXXXXXXXXXXXXXGNSPHXXXXXXXXXXXXXXXXXXXXSYVQSQPHSLTLDFTKPSLFSGNVKSTE-LEXXXXXXXXXXXXXXXXXAITRRRSVSNG 687
            M V++M  PK  MEDQTAIQEAA+QG+KSMEHLIR++S+     +VDCS++TD TVSKFKKVISLLNR+GHARFRRGPVH                  +S                      S+VQ+   S+TLDFT+PS+F    KS+E +E                 AIT   SVS G
Sbjct:    1 MTVDIMRLPK--MEDQTAIQEAASQGLKSMEHLIRVLSNRPEERNVDCSEITDFTVSKFKKVISLLNRSGHARFRRGPVHSPP---------------SSSVPPPVKVTTPAPTQISAPAPVSFVQANQQSVTLDFTRPSVFGAKTKSSEVVEFAKESFSVSSNSSFMSSAITGDGSVSKG 164          
The following BLAST results are available for this feature:
BLAST of FC920408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
WRK11_ARATH1.222e-3045.60Probable WRKY transcription factor 11 OS=Arabidops... [more]
WRK17_ARATH1.596e-3045.30Probable WRKY transcription factor 17 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32007H09EF RVDevelop1 Citrus clementina cDNA clone C32007H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920408 ID=FC920408|Name=FC920408|organism=Citrus clementina|type=EST|length=691bp
GGAACGATTCAAGGAAGAGAGATCGCCTCCACCCTCGCAGCCTCAGCCTT
AAGTTTTACTTTTTCAAAGGGTTTCGTCGAATGACATCTTGAGGCTTTTC
CAAATTGCTCTCATTTGGTAGCAGAAACTTTTTCGTTTTTCCAAATCATG
GCGGTGGAGCTGATGGGATTTCCAAAAAGGATGATGGAAGATCAGACGGC
GATACAAGAAGCTGCAACGCAAGGGATCAAAAGCATGGAGCACCTGATCC
GTCTCATGTCTCATCACCAATCCTCGAATCACGTTGACTGCTCGGACCTC
ACCGATCTCACCGTCTCTAAGTTCAAAAAAGTCATTTCCCTGCTCAACCG
AACCGGTCACGCCCGGTTCAGGCGCGGGCCGGTTCACTCTTCGCCTTCAT
CTTCATCTGCATCTGCGCCAGCCGCCGCCGCCGCCTCAGGCAACTCTCCA
CACACACAGACCTTAACTCTTACTCCGCCTGCTCCTACGATGGCTGTCGC
TCCCTCTACGGCGAGTTACGTCCAGTCACAGCCGCACAGTCTGACTCTTG
ATTTTACAAAACCTAGTTTGTTTAGCGGAAACGTCAAGAGCACTGAGCTC
GAGTTTTCCAAAGACAGCTTCTGTGTGTCGTCGAACTCGTCCTTCATGTC
CTCTGCTATCACCCGGAGACGCAGCGTTTCGAACGGNAAGC
back to top