FC920411

Overview
NameFC920411
Unique NameFC920411
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length698
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920411_ssr4 microsatellite FC920411_ssr4:4..19. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14137 contig Ccv1_Contig14137:1..698. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9B_RAT (Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus GN=Taf9b PE=2 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 6.820e-29
Identity = 58/120 (48.33%), Postives = 85/120 (70.83%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            ++ PRDA ++  +LK MG+ DYEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ +N+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KNAPRDALVMAQILKDMGITDYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_RAT (Transcription initiation factor TFIID subunit 9 OS=Rattus norvegicus GN=Taf9 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.908e-29
Identity = 57/120 (47.50%), Postives = 86/120 (71.67%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            + +P+DA+++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ RN+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_MOUSE (Transcription initiation factor TFIID subunit 9 OS=Mus musculus GN=Taf9 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.908e-29
Identity = 57/120 (47.50%), Postives = 86/120 (71.67%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            + +P+DA+++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ RN+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_HUMAN (Transcription initiation factor TFIID subunit 9 OS=Homo sapiens GN=TAF9 PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.908e-29
Identity = 57/120 (47.50%), Postives = 86/120 (71.67%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            + +P+DA+++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ RN+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_BOVIN (Transcription initiation factor TFIID subunit 9 OS=Bos taurus GN=TAF9 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 8.908e-29
Identity = 57/120 (47.50%), Postives = 86/120 (71.67%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            + +P+DA+++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ RN+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9B_MOUSE (Transcription initiation factor TFIID subunit 9B OS=Mus musculus GN=Taf9b PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 1.984e-28
Identity = 57/120 (47.50%), Postives = 85/120 (70.83%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            ++ PRDA ++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K T+D DDV+LA+Q + + SF+ PP R+ LL++A+ +N+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9B_PONAB (Transcription initiation factor TFIID subunit 9B OS=Pongo abelii GN=TAF9B PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.541e-28
Identity = 56/120 (46.67%), Postives = 84/120 (70.00%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            ++ PRDA ++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K  +D DDV+LA+Q + + SF+ PP R+ LL++A+ +N+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9B_HUMAN (Transcription initiation factor TFIID subunit 9B OS=Homo sapiens GN=TAF9B PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.541e-28
Identity = 56/120 (46.67%), Postives = 84/120 (70.00%), Query Frame = 3
Query:  150 EDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            ++ PRDA ++  +LK MG+ +YEPRVI+Q LE  +RYV  +L DA++YS HA K  +D DDV+LA+Q + + SF+ PP R+ LL++A+ +N+ PLP      G  LPP++  L +PNY+L
Sbjct:   10 KNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRL 129          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_DROME (Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster GN=e(y)1 PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.331e-24
Identity = 54/118 (45.76%), Postives = 81/118 (68.64%), Query Frame = 3
Query:  156 LPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            +P+DA+++ S+LK + V++YEPRV++Q LE  +RYV  +L DA+VY+ HA K TID DDV+LA +  ++ SF+ P  R VL ++A  RN +PLP      G+ LPP++  L   NY+L
Sbjct:   18 VPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLDDVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDRYCLTGVNYKL 135          
BLAST of FC920411 vs. ExPASy Swiss-Prot
Match: TAF9_ENCCU (Transcription initiation factor TFIID subunit 9 OS=Encephalitozoon cuniculi GN=TAF9 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.075e-22
Identity = 52/125 (41.60%), Postives = 77/125 (61.60%), Query Frame = 3
Query:  135 MADGDEDLPRDAKIVKSLLKSMGVEDYEPRVIHQFLELWYRYVVDVLTDAQVYSEHAGKNTIDCDDVKLAVQSKVNSSFSQPPAREVLLELAKNRNKIPLPKSIAGRGIPLPPEQDTLISPNYQL 509
            MA G+   PRDAK++  +L+S+G+E+ EP+VI Q LE  YRY  DVL DA ++++H G+  I   DVKLA+Q+KV   F  PP R+ L E++   N  PL        I +PP    L++ +Y++
Sbjct:    1 MASGENLAPRDAKVISVILRSLGIEECEPKVIIQLLEFAYRYTTDVLEDALLFAKHTGRTHITTSDVKLALQTKVGRHFVPPPPRQYLSEISTMVNSKPLTIPDGENLIRVPPSSSALLNLDYEV 125          
The following BLAST results are available for this feature:
BLAST of FC920411 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
TAF9B_RAT6.820e-2948.33Transcription initiation factor TFIID subunit 9B O... [more]
TAF9_RAT8.908e-2947.50Transcription initiation factor TFIID subunit 9 OS... [more]
TAF9_MOUSE8.908e-2947.50Transcription initiation factor TFIID subunit 9 OS... [more]
TAF9_HUMAN8.908e-2947.50Transcription initiation factor TFIID subunit 9 OS... [more]
TAF9_BOVIN8.908e-2947.50Transcription initiation factor TFIID subunit 9 OS... [more]
TAF9B_MOUSE1.984e-2847.50Transcription initiation factor TFIID subunit 9B O... [more]
TAF9B_PONAB7.541e-2846.67Transcription initiation factor TFIID subunit 9B O... [more]
TAF9B_HUMAN7.541e-2846.67Transcription initiation factor TFIID subunit 9B O... [more]
TAF9_DROME1.331e-2445.76Transcription initiation factor TFIID subunit 9 OS... [more]
TAF9_ENCCU8.075e-2241.60Transcription initiation factor TFIID subunit 9 OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008A04EF RVDevelop1 Citrus clementina cDNA clone C32008A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920411 ID=FC920411|Name=FC920411|organism=Citrus clementina|type=EST|length=698bp
GGGGCGAGCGAGCGAGCGAGAGGGAGGGAAAGTGAGAAACCTGCTGATGC
CGGACAGAGAGAAGTTGGGCAATCCGGCGTCGTTTCCTTCCACTGTTAAT
TTGCTCCAAAAGGGTGTAGGATCCAGCTGAGGAAATGGCAGATGGAGATG
AGGACTTGCCAAGGGATGCAAAGATTGTAAAATCGCTGCTGAAATCAATG
GGTGTGGAGGACTATGAGCCCCGTGTTATACACCAGTTTCTGGAGTTGTG
GTACCGTTATGTTGTCGATGTATTGACTGATGCACAGGTCTATTCTGAGC
ATGCTGGCAAAAATACCATTGATTGTGATGATGTCAAGCTTGCTGTCCAG
TCTAAAGTCAATTCCAGCTTCTCACAACCCCCAGCAAGAGAGGTACTACT
GGAATTAGCTAAAAACAGGAATAAAATTCCATTGCCAAAGTCAATAGCAG
GGCGTGGTATCCCACTTCCTCCTGAGCAGGACACATTGATTAGCCCTAAC
TACCAGCTGTCGATTGAAAAGAAGGAATCTGCTCAGGCAGCGGAAGAAAT
GGAAGAAGATGAACAGAGTACCGAGCCGAATGCATCTGAAGAACAGAGGA
CAGATATGCTGCAACAAACCCCCTCAAAGGTATCATTTCCCCTTGCTAGA
CGTACAAAGTGAGATCTTGATTTGCTGGNCTTTCGGGATCATCTCATC
back to top